KEGG   Zea mays (maize): 100273188Help
Entry
100273188         CDS       T01088                                 

Definition
uncharacterized LOC100273188
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
zma  Zea mays (maize)
Brite
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     100273188
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 358 aa AA seqDB search
MASATRQFARAATRATRNGFAIAPRQVIRQQGRRYYSSEPSQKSSSAWVWLTGAAVAGGA
GYYFYANGASSATPKVFNPTKDDYQKVYNEIAARLEEKDDYDDGSYGPVLVRLAWHASGT
YDKETGTGGSNGATMRFAPEADHGANAGLAAARNFLEPVKEKFPWITYSDLWILAGVCAI
QEMLGPAIPYRPGRSDRDVSGCTPDGRLPDASKRSGHLRDIFYRMGFNDQEIVALSGAHA
LGRCHTDRSGYEGPWTFSPTVLTNDYFRLLVEEKWQWKKWNGPAQYEDKSTKSLMMLPSD
IALIEDKKFKPWVEKYAKDNDAFFKDFSDVVLRLFELGVPFAQGTENQRWTFKPTNQE
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggcctccgctacccgacagttcgcccgcgcggccactcgcgccacccgcaatggcttc
gccattgctcctagacaggtcatccgccagcagggtcgccgatactattcttctgaaccc
tcacagaagtcatcttccgcctgggtgtggttgactggtgccgctgttgctggtggtgct
ggttactatttctacgccaacggcgcttcttccgctacccccaaggttttcaaccctacc
aaggacgactatcagaaggtttataacgagattgctgctcgcctggaggagaaggatgac
tatgatgacggcagctacggccccgttctcgtacgtctcgcttggcacgccagcggtacc
tacgacaaggagactggcactggcggcagcaacggcgccaccatgcgattcgcccctgag
gctgaccacggcgccaatgctggcctggctgctgcccgcaacttcctcgagcccgtgaag
gagaaattcccttggatcacctactccgatctctggatccttgctggtgtatgcgctatc
caagagatgctgggccctgccattccttaccgacctggtcgctctgatcgtgatgtctct
ggttgcacacccgacggacgtcttcccgacgcctcaaagcgctctggacatctccgagac
attttctaccgcatgggcttcaacgatcaggagattgtcgctctttctggcgcccacgcc
cttggtcgctgccacactgaccgatcaggctacgagggcccctggactttctcccctacc
gttctgaccaatgactacttccgcctccttgtcgaagagaagtggcagtggaagaagtgg
aatggccctgcccagtacgaagacaagtctaccaagtctctgatgatgcttcctagcgac
attgccttgatcgaggacaagaagtttaagccatgggtcgagaagtacgccaaggataac
gatgccttctttaaggacttttccgacgttgttctccgactatttgaactcggtgttcct
ttcgctcagggtactgagaaccagcgctggacctttaagcctacaaaccaggaataa

DBGET integrated database retrieval system