KEGG   Zea mays (maize): 100273297Help
Entry
100273297         CDS       T01088                                 

Definition
putative glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
zma  Zea mays (maize)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100273297
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100273297
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100273297
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 168 aa AA seqDB search
MAASSTATSVHDFIVKDASGKDVDLSTYKGKVLLIVNVASQCGLTNSNYTELAQLYEKYK
DQGFEILAFPCNQFGGQEPGTNEEIVQFACTRFKAEYPIFDKVDVNGSNAAPIYKFLKSS
KGGLFGDSIKWNFSKFLVDKEGRVVDRYAPTTSPLSIEKDIKKLLGSS
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctcgtcgaccgccacctccgtccacgacttcatcgtcaaggatgcgagcggc
aaagacgttgacctcagcacctacaaggggaaggttcttctcattgttaacgtcgcatcc
cagtgtggcttaaccaactccaactacactgagctggcccagctctatgagaagtacaag
gaccaaggctttgaaatcctggctttcccatgcaaccagtttggtgggcaggagcctggt
accaatgaggagattgtccagtttgcctgcacacgcttcaaggctgagtaccccatcttc
gacaaggttgatgtcaacggtagcaatgctgcgcccatctacaagttcttgaaatctagc
aaaggtggccttttcggcgacagcatcaagtggaacttttccaagttcttggttgacaag
gagggacgtgttgtggatcgctatgctccaaccacttcacccctgagcattgagaaggat
atcaagaagctgcttgggagctcttaa

DBGET integrated database retrieval system