KEGG   Zea mays (maize): 100273347Help
Entry
100273347         CDS       T01088                                 

Definition
uncharacterized LOC100273347
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
zma  Zea mays (maize)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100273347
   01230 Biosynthesis of amino acids
    100273347
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100273347
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100273347
Enzymes [BR:zma01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     100273347
Exosome [BR:zma04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100273347
  Exosomal proteins of melanoma cells
   100273347
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 254 aa AA seqDB search
MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQ
KRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYD
VPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKR
VLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVR
KAMEAVAAQGKVKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctacaagctggtgctgatccggcatggcgagagcgcctggaacctggagaac
cgcttcagcggctggtacgatgccgacctgagcccagcgggccacgaggaggcgaagcgc
ggcgggcaggcgttgcgagatgctggctatgagtttgacatctgcttcacctctgtgcag
aagagagcaatccgcaccctctggacagtcctggatgccattgaccagatgtggttgcca
gtggtcaggacctggcgtctcaatgagcgacactatgggggtctaacaggtctcaataaa
gcagagactgctgctaagcatggtgaggcacaggtaaagatctggagacgatcttacgat
gtcccgccacctccaatggagcctgatcatcccttctacagcaacatcagcaaggaccgc
aggtacgcagaccttactgaggaccagctaccctcctgtgagagcctgaaggatactatt
gccagggcactgcccttctggaatgaagaaattgtcccccagatcaaggaggggaaaagg
gtcttgattgctgcccatggcaacagcctacggggcattgtcaagcatctggagggtctg
tcagaagaggccatcatggagctgaacctgccaactggcatccccatcgtctatgaactg
gacaagaacttgaagcccatcaagcccatgcagttcctgggagatgaggagaccgtgcgt
aaagccatggaagctgtggctgctcagggcaaggtgaagaagtga

DBGET integrated database retrieval system