KEGG   Zea mays (maize): 100273491Help
Entry
100273491         CDS       T01088                                 

Definition
histone H2B.4
Orthology
K11252  
histone H2B
Organism
zma  Zea mays (maize)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 137 aa AA seqDB search
MAPKAEKKPAEKKPTEEKAEKKPRAEKRVPGKEGGEKKGKKKAKKSVETYKIYIFKVLKQ
VHPDIGISSKAMSIMNSFINDIFEKLAAEAAKLARYNKKPTITSREIQTSVRLVLPGELA
KHAVSEGTKAVTKFTSS
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaaggccgagaagaagcccgcggagaagaagccgacggaggagaaggccgag
aagaagcccagggcggagaagcgcgtgccgggcaaggagggcggcgagaagaaggggaag
aagaaggccaagaagagcgtcgagacgtacaagatctacatcttcaaggtgctcaagcag
gtgcacccggacattggtatctcgtccaaggccatgtccatcatgaactccttcatcaac
gacatcttcgagaagctggctgccgaggccgccaagctcgcccgctacaacaagaagccc
accataacctcccgggagatccagacttcggtgcgcctcgtccttcctggcgagctcgcc
aagcacgccgtctccgagggcaccaaggccgttaccaagtttacttcctcttag

DBGET integrated database retrieval system