KEGG   Zea mays (maize): 100273924Help
Entry
100273924         CDS       T01088                                 

Definition
hypothetical protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
zma  Zea mays (maize)
Brite
Enzymes [BR:zma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100273924
Transcription factors [BR:zma03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    100273924
Mitochondrial biogenesis [BR:zma03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100273924
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 362 aa AA seqDB search
MINQLRQEEDDRKLQKKSKTKKIITKRALKAAGHTDLSGNASKDAMLMQKLGETIYPMKE
DFIMVHLQYSCSHCCTLMVSGRRWVCHQCRSFYICDKCYDAEQQLDDRERHPSNNRDTHM
LHPVDILGVPKDTKDRDDILESEFFDTRQAFLSLCQGNHYQYDTLRRAKHSSMMVLYHLH
NPTAPAFVTTCNVCSHDIETGQGWRCEICPDFDVCNSCFQKGVVTHPHKLTNHPSAADRD
AQNAEARQMRVQQLRKMLDLLVHASTYRSGSCQYPNCRKVKGLFRHGMQCKTRASGGCVL
CKKMWYMLQLHARACKDSDCNVPRCRDLKEHLRRLQQQSDSRRRAAVNEMMRQRAAEVAA
NE
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatcaactccgacaagaagaagacgaccgcaaactccagaaaaagagtaaaaca
aagaagattattacaaaaagagctcttaaagctgctggccacaccgatctcagcgggaat
gcttccaaggatgctatgttgatgcaaaagcttggtgaaaccatatatcctatgaaggaa
gatttcattatggtccatttacagtattcgtgtagtcactgttgtacccttatggtgtct
ggaagacgttgggtttgtcatcaatgcagaagcttttacatctgcgacaagtgttatgat
gcagaacagcaacttgacgacagggagaggcacccgagtaataatagagacacacatatg
ctccatccggttgatattcttggggtgcccaaagataccaaagatagagatgacatcttg
gaaagtgagttctttgacaccagacaggcattccttagtctttgccaaggaaatcattat
cagtatgacacacttcgacgcgcaaagcattcatcaatgatggtgttgtaccacctacac
aatccaactgcaccagcatttgtcactacgtgcaatgtctgcagtcatgatattgaaact
ggtcaaggctggcggtgcgagatttgtccagattttgatgtgtgcaactcttgtttccaa
aaaggagtggttactcatcctcacaagttaacgaaccatccatcagctgctgaccgtgat
gctcaaaacgcagaagctcggcaaatgcgtgtccagcagctaagaaagatgcttgatctt
ctggtacatgcgtcgacataccgctctggtagttgccagtatcccaactgccgaaaagtc
aaggggctattccgtcatgggatgcagtgcaaaacgcgtgcttcaggagggtgtgtcctt
tgcaagaaaatgtggtacatgcttcaactccatgcccgagcttgcaaggattcagactgc
aatgtgccgcggtgcagggatctgaaggagcatcttagaaggttgcaacagcagtctgat
tccaggaggagggctgctgtgaatgaaatgatgaggcaaagagcggcggaggtcgctgca
aacgaatag

DBGET integrated database retrieval system