KEGG   Zea mays (maize): 100273924Help
Entry
100273924         CDS       T01088                                 

Definition
uncharacterized LOC100273924
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
zma  Zea mays (maize)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 362 aa AA seqDB search
MINQLRQEEDDRKLQKKSKTKKIITKRALKAAGHTDLSGNASKDAMLMQKLGETIYPMKE
DFIMVHLQYSCSHCCTLMVSGRRWVCHQCRSFYICDKCYDAEQQLDDRERHPSNNRDTHM
LHPVDILGVPKDTKDRDDILESEFFDTRQAFLSLCQGNHYQYDTLRRAKHSSMMVLYHLH
NPTAPAFVTTCNVCSHDIETGQGWRCEICPDFDVCNSCFQKGVVTHPHKLTNHPSAADRD
AQNAEARQMRVQQLRKMLDLLVHASTYRSGSCQYPNCRKVKGLFRHGMQCKTRASGGCVL
CKKMWYMLQLHARACKDSDCNVPRCRDLKEHLRRLQQQSDSRRRAAVNEMMRQRAAEVAA
NE
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatcaactccgacaagaagaagacgaccgcaaactccagaaaaagagtaaaaca
aagaagattattacaaaaagagctcttaaagctgctggccacaccgatctcagcgggaat
gcttccaaggatgctatgttgatgcaaaagcttggtgaaaccatatatcctatgaaggaa
gatttcattatggtccatttacagtattcgtgtagtcactgttgtacccttatggtgtct
ggaagacgttgggtttgtcatcaatgcagaagcttttacatctgcgacaagtgttatgat
gcagaacagcaacttgacgacagggagaggcacccgagtaataatagagacacacatatg
ctccatccggttgatattcttggggtgcccaaagataccaaagatagagatgacatcttg
gaaagtgagttctttgacaccagacaggcattccttagtctttgccaaggaaatcattat
cagtatgacacacttcgacgcgcaaagcattcatcaatgatggtgttgtaccacctacac
aatccaactgcaccagcatttgtcactacgtgcaatgtctgcagtcatgatattgaaact
ggtcaaggctggcggtgcgagatttgtccagattttgatgtgtgcaactcttgtttccaa
aaaggagtggttactcatcctcacaagttaacgaaccatccatcagctgctgaccgtgat
gctcaaaacgcagaagctcggcaaatgcgtgtccagcagctaagaaagatgcttgatctt
ctggtacatgcgtcgacataccgctctggtagttgccagtatcccaactgccgaaaagtc
aaggggctattccgtcatgggatgcagtgcaaaacgcgtgcttcaggagggtgtgtcctt
tgcaagaaaatgtggtacatgcttcaactccatgcccgagcttgcaaggattcagactgc
aatgtgccgcggtgcagggatctgaaggagcatcttagaaggttgcaacagcagtctgat
tccaggaggagggctgctgtgaatgaaatgatgaggcaaagagcggcggaggtcgctgca
aacgaatag

DBGET integrated database retrieval system