KEGG   Zea mays (maize): 100274083Help
Entry
100274083         CDS       T01088                                 

Gene name
trh1
Definition
thioredoxin h homolog1
Orthology
K11252  
histone H2B
Organism
zma  Zea mays (maize)
Brite
Exosome [BR:zma04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100274083 (trh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 148 aa AA seqDB search
MAPKAEKKPAEKKPAAEEKAEKTTAGKKPKAEKRLPASKSSGKEGGEKKGKKKAKKSVET
YKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAGEAAKLARYNKKPTITSREIQT
SVRLVLPGELAKHAVSEGTKAVTKFTSN
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaaggcggagaagaagccagcggagaagaagccggcggccgaggagaaggcg
gagaagacgaccgcagggaagaagcccaaggccgagaagcggctgcccgcgtccaagtcc
tccggcaaggagggcggcgagaagaaggggaagaagaaggccaagaagagcgtggagacc
tacaagatctacatcttcaaggtgctgaagcaggtgcaccccgacatcggcatatcctcc
aaggccatgtccatcatgaactccttcatcaacgacatctttgagaagctggccggcgag
gccgccaagctggcgcggtacaacaagaagcccaccatcacgtcccgcgagatccagacc
tccgtgcgcctagtcctccccggagagctcgccaagcacgccgtctccgagggaaccaag
gccgtcaccaagttcaccagcaactga

DBGET integrated database retrieval system