KEGG   Zea mays (maize): 100274083Help
Entry
100274083         CDS       T01088                                 

Gene name
trh1
Definition
(RefSeq) thioredoxin h homolog 1
  KO
K11252  histone H2B
Organism
zma  Zea mays (maize)
Brite
Chromosome [BR:zma03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100274083 (trh1)
Exosome [BR:zma04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100274083 (trh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF Activator-TraM YscO-like TFIID_20kDa RP-C 4HB_MCP_1
Motif
Other DBs
NCBI-GeneID: 100274083
NCBI-ProteinID: NP_001278528
UniProt: B4FYZ0
Position
3
AA seq 148 aa AA seqDB search
MAPKAEKKPAEKKPAAEEKAEKTTAGKKPKAEKRLPASKSSGKEGGEKKGKKKAKKSVET
YKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAGEAAKLARYNKKPTITSREIQT
SVRLVLPGELAKHAVSEGTKAVTKFTSN
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaaggcggagaagaagccagcggagaagaagccggcggccgaggagaaggcg
gagaagacgaccgcagggaagaagcccaaggccgagaagcggctgcccgcgtccaagtcc
tccggcaaggagggcggcgagaagaaggggaagaagaaggccaagaagagcgtggagacc
tacaagatctacatcttcaaggtgctgaagcaggtgcaccccgacatcggcatatcctcc
aaggccatgtccatcatgaactccttcatcaacgacatctttgagaagctggccggcgag
gccgccaagctggcgcggtacaacaagaagcccaccatcacgtcccgcgagatccagacc
tccgtgcgcctagtcctccccggagagctcgccaagcacgccgtctccgagggaaccaag
gccgtcaccaagttcaccagcaactga

DBGET integrated database retrieval system