KEGG   Zea mays (maize): 100274242Help
Entry
100274242         CDS       T01088                                 

Definition
(RefSeq) histone H2B.3
  KO
K11252  histone H2B
Organism
zma  Zea mays (maize)
Brite
Chromosome and associated proteins [BR:zma03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100274242
Exosome [BR:zma04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100274242
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like RP-C TFIID_20kDa
Motif
Other DBs
NCBI-GeneID: 100274242
NCBI-ProteinID: NP_001142082
UniProt: B4FZQ6
Position
2
AA seq 152 aa AA seqDB search
MAPKADKKPAAKKPAEEPATEKAEKAPAGKKPKAEKRLPAGKSAGKEGGEGKKGKKKAKK
SVETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAAESAKLARYNKKPTVTSR
EIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggcacccaaggcggacaagaagccggcggcgaagaagcctgcagaggagcccgcgaca
gagaaggcggagaaggctccggcggggaagaagcccaaggccgagaagcgcctcccggcg
ggcaagtccgccggtaaggagggcggcgagggcaagaaggggaaaaagaaagcgaagaag
tccgtggagacctacaagatctacatcttcaaggtgctgaagcaggtgcaccccgacatc
ggcatctcgtccaaggccatgtccatcatgaactccttcatcaacgacatcttcgagaag
ctcgcggccgagtccgccaagctggcgcgctataacaagaagcccaccgtcacctcccgc
gagatccagacctcggtgcgcctcgtcctccccggcgagcttgccaagcacgccgtctcc
gagggcaccaaggccgtcaccaagttcacctcttcttaa

DBGET integrated database retrieval system