KEGG   Zea mays (maize): 100274352Help
Entry
100274352         CDS       T01088                                 

Gene name
cl15956_1a
Definition
LOC100274352
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
zma  Zea mays (maize)
Brite
Enzymes [BR:zma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100274352 (cl15956_1a)
Peptidases [BR:zma01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100274352 (cl15956_1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 366 aa AA seqDB search
MGAAGSRLEKALGEQFPEGERYFGLENFGNTCYCNSVLQALYFCVPFRDQLLEYYANNKN
TGDVEENMLTCLADLFSQISSQKKKTGVIAPKRFIQRLKKQNEIFRSYMHQDAHEFLNFL
LNELVDILEKEHNAARESLQNLSLQKNSNGPIDGQPNGSHKELAVTWVHKCFQGILTNET
RCLRCETVTDRDETFFDLSLDIEQNSSLTSCLKNFSSTETLNAEDKFFCDKCCSLQEAQK
RMKIKKPPNILVIHLKRFKYIEQLQRYKKLSYRVVFPLELKLLNTVDNSDLEYSLFAVVV
HVGSGPNHGHYISLVKSHNHWLFFDDENVEMTDESMVQAFFGSPQEFSGNTDNGYILFYE
SLAERS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcggcgggctccaggttggagaaggcgctgggcgagcagttccccgagggcgag
cgctacttcggcctcgagaacttcggaaacacctgctactgcaacagcgtgctgcaggca
ctttatttttgtgttcctttccgtgatcaattgctggagtactatgcaaacaataaaaac
accggagatgttgaagagaacatgctaacctgcctggctgatctgttctctcagatcagt
agccagaagaagaaaacaggggttattgctcctaagcgttttatacaacgattgaagaaa
caaaatgagattttccgcagctatatgcatcaggatgctcatgagtttctgaatttttta
ctgaatgagctagttgacattctagagaaagaacataatgctgcaagagagtctcttcaa
aatctctcactccaaaagaattcaaatggccctattgatggccaacccaatggtagtcac
aaagaattagctgtcacatgggttcataaatgcttccagggaatattgactaatgaaaca
aggtgtctgagatgtgaaactgtgactgatagagatgaaacattttttgacctgagcctg
gacatcgaacagaatagttcactcaccagctgtcttaagaacttcagctcaacagagact
ttgaatgcagaggacaagttcttctgtgacaaatgctgcagtttgcaggaagcacaaaaa
aggatgaaaataaaaaaaccaccaaacattctagtaattcatctcaagcggttcaagtat
attgagcagcttcagcgctacaaaaaactatcatacagagtggttttcccactggagctt
aaacttcttaatacagttgataattcggacttggaatactcccttttcgctgtggtagtt
catgttggaagtgggccaaaccatggccactatatcagtttggttaagagccacaatcat
tggttattctttgatgacgagaacgttgagatgactgatgagtccatggtacaggcattc
tttggctcaccgcaggagttcagtggtaatactgataatggctacatactcttctatgaa
agccttgctgaaagaagttga

DBGET integrated database retrieval system