KEGG   Zea mays (maize): 100274394Help
Entry
100274394         CDS       T01088                                 

Definition
uncharacterized LOC100274394
Orthology
K10886  
DNA-repair protein XRCC4
Organism
zma  Zea mays (maize)
Pathway
Non-homologous end-joining
Class
Genetic Information Processing; Replication and repair; Non-homologous end-joining [PATH:zma03450]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 290 aa AA seqDB search
MAAASSAAPARHSCAKLSVPVEDPKAVTAGGGTVFVKATWLPSRFSLAVTDGAGAWVADA
SDHEVRLRAEQWDQPVADYIALAERYLAFQQPGSTYSFHDAGKGQRRLAWTFERQGTKLE
WRWKLQPSPNTQQTISEILDFLMDANIRLSEEVVRKTQSFDKLKQEAEKCLQQSERFNNE
KAEFEQAAFSKFVAVLNSKKAKLRQLRDKVVELESAVKPPKEEAGQEQEQEQENSTDRTE
LFEAESDKEASAKDEHSSETGSGNVPTSPGESAATSRGRGRGRGRKKARR
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcctcttctgcggcgccggcgaggcacagctgcgcaaagctctcggtccca
gtggaggaccccaaagcagtgacagcgggcggtggcaccgtctttgtcaaagccacgtgg
ctgccgtcccgcttctccctcgccgtcaccgacggtgccggcgcctgggtcgccgacgcc
tccgaccacgaggtgcgcctccgcgccgagcagtgggatcagcccgtcgccgattacatc
gccctcgccgagcgctacctcgccttccaacagcctggttccacgtattccttccatgac
gccggcaagggccaacgcaggctcgcttggacatttgaaagacaaggtaccaagttggaa
tggcggtggaagctgcagccttcaccaaacacgcagcagactatatctgagatcctggat
tttcttatggatgcaaatatacgcttaagtgaagaggttgtgaggaaaacacaatccttt
gacaagttgaaacaagaagctgagaagtgcttgcaacaaagtgagagatttaacaatgag
aaagctgagttcgaacaagccgccttttcaaagtttgtggctgtgttgaattcgaagaag
gccaagctcagacaactcagagataaagttgtggagctcgaatccgctgtcaagcctcca
aaggaggaggcaggtcaggagcaggagcaggagcaggagaactcaacggaccggacagag
ctcttcgaggcagagagtgacaaagaagcaagcgccaaggatgaacactcctccgagaca
ggcagcggcaacgttcctacttctcctggggaatcggcagctacctccagaggaagagga
cgagggagaggtcgtaagaaggcaagaagatag

DBGET integrated database retrieval system