KEGG   Zea mays (maize): 100274529Help
Entry
100274529         CDS       T01088                                 

Definition
uricase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
zma  Zea mays (maize)
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100274529
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    100274529
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     100274529
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 270 aa AA seqDB search
MAENFQLQGRHGKSRVRVSRVWRRPAAAGGDVIVEWNVAVSIVSDCLPSYTSSDNSAIVA
TDSIKNTVYVKAKECTEVVSMEEFAVILGRHFTSLYPQVSEATVTIVERPWERVTVDGKP
HSHGFKVGVEKHSTEVIVKKSGSLRINSGIQGYSLLKTTQSGFEGFVTDRYRLLPDTRER
IVATEVTAWWRYPFEHVSQLPSKPFCFTQRYQDVKKVLAETFFGPPDVGVYSPSVQNTLY
LMAKEVLTRSVTLIRSSLVFSPLKYAHSFL
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaacttccaactccagggccggcacggcaagtcccgcgtccgcgtctcccgc
gtctggcgccgcccggccgcggcggggggcgacgtcatcgttgagtggaacgtcgccgtc
agtatcgtctccgactgcctcccctcctacacctccagcgacaactccgccatcgtcgcc
acagattccatcaagaacaccgtgtatgtcaaggcgaaagagtgcacggaagtggtgtcc
atggaggaattcgccgtgattcttggaaggcatttcacctcgctgtaccctcaggtttca
gaggccacggtgactatcgtggagcgcccatgggagcgtgtgactgtcgacggaaagcct
cattcgcatgggttcaaagttggtgttgagaagcacagcacagaggtcattgtaaaaaaa
tctggaagcctgcgtataaattctggaattcaaggatactcgctgctaaagacaactcag
tctgggtttgaagggtttgtgacggatcgctataggcttcttcctgatacaagggaaagg
atagtagcaacagaagttactgcttggtggaggtatccctttgaacatgtttcgcagctc
ccatcgaagccattctgcttcacgcagagatatcaggatgtaaagaaagtccttgcagag
acgttctttggtcctccggatgttggtgtgtatagtccatccgtacaaaatacgctatac
ctcatggccaaggaagtccttacaaggtctgtaactctgattcggtcgtcccttgttttc
agccccttaaaatatgcacacagttttctttga

DBGET integrated database retrieval system