KEGG   Zea mays (maize): 100274554Help
Entry
100274554         CDS       T01088                                 

Definition
uncharacterized LOC100274554
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
zma  Zea mays (maize)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:zma00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:zma00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:zma00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:zma00603]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 423 aa AA seqDB search
MARAPSSWTPSLAMVLLVVAAAAVVASSEAARVPAAVGNWTGEELRGAAARRGGRRSRRR
AFENGLGRTPQMGWNSWNHFGCGINENLIKQTADALVNTGLAKLGYEYVNIDDCWAESDR
DHQGSFVANRQTFPSGIKALADYVHAKGLKLGIYSDAGTRTCSQKMPGSLDHEEQDVKTF
SSWGIDYLKYDNCNDAGRSVMERYTKMSNAMKTYGKGIFFSLCEWGRQNPATWAGGMGNS
WRTTDDIADNWGSMTSRADQNDRWASYAGPGGWNDPDMLEVGNGGMSEAEYRSHFSIWAL
AKAPLLIGCDVRAMSQQTMGILSNSEVIAVNQDSQGAQGKKVQSSNGLEVWAGPLSNNRK
AVVLWNRQGYQATITAQWSSIGLASSTAVTARDLWAHSSFSAQGQLSASVPPHDCKMYVL
TPN
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcgccccgagctcgtggacgccgtccctcgccatggtgctcctcgtcgtggcc
gccgcggccgtggtcgcgtcgtcggaggcggccagggtgcccgccgccgtcggcaactgg
acgggggaggagctgcgcggggccgcggcgaggcggggcggccggcgctcccggcgccgc
gcgttcgagaacggcctcggccggacgccgcagatggggtggaatagctggaaccacttc
ggctgcgggatcaacgagaacctcatcaagcagacagctgatgcgctggtcaacaccggt
ctggcgaagctgggctacgagtatgtcaacatagatgattgctgggcggagtctgacagg
gaccaccagggaagcttcgttgcaaacagacaaaccttcccctctggcatcaaggcgctc
gcggactacgtgcacgccaaggggctcaagcttggcatctacagcgatgctgggacacgg
acgtgcagccagaaaatgccagggtcacttgaccacgaggagcaggacgtgaagacattc
tcgtcctggggtatcgattatctgaaatacgacaactgcaacgacgccggcaggagcgtc
atggagaggtatacgaagatgagcaacgctatgaagacgtatgggaagggcatcttcttc
tcgctgtgcgaatgggggaggcaaaaccctgctacctgggcaggcggcatggggaacagc
tggagaacgaccgatgatatcgccgacaactggggcagcatgacgtctcgtgcagaccag
aacgacaggtgggcttcctacgccggacctggcgggtggaacgatcctgacatgcttgag
gtgggcaacggcggcatgtccgaggcggagtaccgctctcacttcagcatctgggcgctc
gccaaggctccgcttctgatcgggtgcgacgtgcgggcgatgagccagcagacgatgggc
atactcagcaactcggaagtcatcgccgtgaaccaagatagccaaggtgcgcagggaaag
aaagtgcagtccagcaatggcttggaggtttgggctgggccgctcagcaacaacaggaag
gccgtggttctctggaaccggcagggataccaggcaaccatcaccgcacagtggtcgagc
atcgggctcgcttcttccactgctgtcactgctcgcgatctatgggcgcactcgtcgttc
tcggctcaaggccagctatcagcttcggtgccacctcacgactgcaagatgtatgtcttg
acgccgaactag

DBGET integrated database retrieval system