KEGG   Zea mays (maize): 100274566Help
Entry
100274566         CDS       T01088                                 

Definition
hypothetical protein
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
zma  Zea mays (maize)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100274566
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    100274566
Enzymes [BR:zma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     100274566
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 409 aa AA seqDB search
MPPPHGALHGRRRWPPEPRAYPLHQRGDGQIPGLDMGSPRIPSCEVSGGCRGVVQDSVDE
VATSSHAAEANAGGTTEQEGNGSPVAAAAAYSPVVAGVDGIRIRRRPVTGPAVHYVGPFQ
FRLENEGNTPRNILEKIIWNKDVEVSQMKERRPLYMLKGPLEAAPPARDFVGALKASYDR
TGLPALIAEVKKASPSRGVIRENFDPVQIAQAYEKNGAACLSVLTDEKYFQGSFYNLEAI
RNAGVQCPLLCKEFIIDAWQLYYARSKGADAVLLIAAVLPDRDIKYMLKICKILGMAALV
EVHDEREMDRVLGIDGVQLIGINNRNLETFEVDITNTKKLLEGERGQVIAQKDVIVVGES
ALFTPDDISFVQNAGVKAVLVGESLIKQEDPGKAIAGLFGKDISHAGAT
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgccgccccctcacggcgccctccatggacgccgccgttggccgcccgagccgcgcgcc
tatccgctgcaccagcgcggagacggtcagattcccggtctcgatatgggttcgcctcga
attccgagttgtgaggtttcgggtgggtgtcgtggtgtcgtgcaggactcggtggatgag
gtcgcgacgagctcgcacgccgcggaggccaacgcggggggcaccacggagcaagagggc
aacgggagccccgtggccgccgctgccgcgtactcccccgtggtcgccggcgtcgacggg
ataaggatccggcggcggcccgtgacggggcccgcggtgcactacgtgggcccgttccag
ttccgcctcgagaacgaggggaacacgccgcggaacatcctcgagaaaatcatctggaac
aaggacgtcgaggtttcgcagatgaaggagaggaggcccctgtacatgctgaagggtccg
cttgaggctgctccccccgctagggacttcgttggggcgctcaaggcgtcctacgatcga
actggcttgcctgctctgattgcggaggtcaagaaggcttcaccaagccggggtgttatc
agggagaattttgatccggttcagatcgctcaggcatatgagaaaaacggagcagcatgc
cttagtgttcttacagatgaaaagtactttcagggaagtttttacaacttggaggctata
cgcaatgctggagtccagtgccctcttctgtgcaaagagttcattattgatgcttggcaa
ctttactatgcacggtccaagggtgcagatgctgttcttctaatagctgctgtattacct
gaccgcgatatcaaatacatgttgaaaatttgcaaaatacttgggatggctgctttagtt
gaggttcatgacgaaagagaaatggaccgtgttttagggattgatggtgtacagctcatc
ggcatcaataaccgtaatctcgagacatttgaagttgatattacaaacacaaaaaagctt
ctggaaggtgaacgaggacaggttatagctcaaaaggatgtaattgttgtaggagaatct
gcgctgttcactcctgatgatatctcgttcgttcaaaacgctggggtcaaagcggttctc
gtcggggaatccctcatcaagcaggaggatccagggaaagcaatcgctgggcttttcggc
aaagatatctcgcatgctggtgctacctag

DBGET integrated database retrieval system