KEGG   Zea mays (maize): 100275606Help
Entry
100275606         CDS       T01088                                 

Definition
uncharacterized LOC100275606
Orthology
K10570  
DNA excision repair protein ERCC-8
Organism
zma  Zea mays (maize)
Pathway
Nucleotide excision repair
Ubiquitin mediated proteolysis
Module
Cul4-DDB1-CSA complex
Brite
KEGG Orthology (KO) [BR:zma00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100275606
  Replication and repair
   03420 Nucleotide excision repair
    100275606
Ubiquitin system [BR:zma04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   Cul4 complex
    target recognizing subunit (DCAF)
     100275606
DNA repair and recombination proteins [BR:zma03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      100275606
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 466 aa AA seqDB search
MWLEEVRRRERGELRARRFEAAARACRTASLALSNRKEFVTPHHGAVNSLQVDLTEGRYL
LSGASDGSAAVFDVWNATEYETGFIAKHRNILLVDKQHQNGHKFAISAAVWYPVDTGLFV
TASFDQFVKVWDTNSTQVVMEFKMPGKVYTAAMSPIATTHVLIATGSADVQVRLCDIASG
AFTHTLSGHRDGIMSLEWSASSEWILMSGGCDGAIRFWDIRRAGCFRVLDQSRSQLGKRP
LVKSALYKPNCPNIRKFGSIRIRTQNCIQDHTDSLGPSPSARRRTGISKKSSSALRKIQN
PTHGHMQQRLHPGLSSSQNRATAHYGAVTGLRTTADGMYLLSSGSDSRLRLWDIDSGCNT
LVNFEAMRLQTGKPLQLAVTEDPSLVFVPCMASIKAYNLWSGKTFQTFRGHYELVNCCYY
SEQDQELYTGSNDRQILVWSPSTPAFTKMEDDDKILSAADEDNWSD
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtggctggaagaggtgaggcggagggagcgtggagagcttcgcgctcggcggtttgag
gccgccgcccgagcgtgccgcacggcctcgctcgcgctctccaatcgcaaggagtttgtc
accccacatcacggcgccgtcaactcgctccaggttgatttgacagaggggaggtacctg
ctctccggggcatcggatgggtcggccgctgtgttcgatgtgtggaacgcgaccgaatac
gaaaccgggttcatagcaaagcacaggaacatactgcttgtggacaagcaacaccagaat
ggccacaagttcgccatctcggcggccgtttggtatcctgtggatacggggctgtttgtc
acagcatcctttgaccagtttgtcaaagtttgggatacaaattcgactcaagtcgtcatg
gaatttaagatgcctggaaaagtgtacactgcagccatgtctccaatcgcaacaacgcac
gtgctcattgctactgggagtgcagatgttcaggtccgtctatgtgacattgcttctgga
gcctttacccacacgttgtctggtcatcgtgatggtatcatgtctttggagtggtctgcc
tcaagtgagtggattttgatgagtggtggctgtgacggggcaatacgtttttgggacatt
agaagagctggatgctttcgggttctggaccaatcaaggtctcaacttggaaaaaggccc
cttgttaaaagtgctctatataagccaaactgcccaaacataaggaagtttggctcaatt
cggattcggacccagaattgcatccaggatcacacagattccttaggaccttcaccttcc
gcaaggagaaggacaggcatttctaagaagagttcatcagctttgcgcaaaattcaaaac
ccgacacatggacacatgcaacagagattgcatcctggtttgtcatctagtcaaaaccgt
gctactgctcattatggtgctgttactggtttacgaacaactgcagatgggatgtacctt
cttagctcaggatctgattctcgcttaagactatgggacatcgattcaggctgcaatacg
ctggtcaattttgaagctatgcgattgcagacaggcaagccattacaattagctgtcact
gaggatccttcacttgtatttgttccatgtatggcaagcatcaaggcatacaatttatgg
tctggtaaaacatttcaaacattccgggggcactatgaacttgtgaattgctgctactat
agtgaacaggaccaagaactttatactggcagcaacgacaggcaaattcttgtgtggtct
ccatcaactccagcttttactaaaatggaagatgatgacaagatcctttctgcagctgat
gaggataactggagcgactga

DBGET integrated database retrieval system