KEGG   Zea mays (maize): 100275606Help
Entry
100275606         CDS       T01088                                 

Definition
uncharacterized LOC100275606
Orthology
K10570  
DNA excision repair protein ERCC-8
Organism
zma  Zea mays (maize)
Pathway
Nucleotide excision repair
Ubiquitin mediated proteolysis
Module
Cul4-DDB1-CSA complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:zma04120]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:zma03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 466 aa AA seqDB search
MWLEEVRRRERGELRARRFEAAARACRTASLALSNRKEFVTPHHGAVNSLQVDLTEGRYL
LSGASDGSAAVFDVWNATEYETGFIAKHRNILLVDKQHQNGHKFAISAAVWYPVDTGLFV
TASFDQFVKVWDTNSTQVVMEFKMPGKVYTAAMSPIATTHVLIATGSADVQVRLCDIASG
AFTHTLSGHRDGIMSLEWSASSEWILMSGGCDGAIRFWDIRRAGCFRVLDQSRSQLGKRP
LVKSALYKPNCPNIRKFGSIRIRTQNCIQDHTDSLGPSPSARRRTGISKKSSSALRKIQN
PTHGHMQQRLHPGLSSSQNRATAHYGAVTGLRTTADGMYLLSSGSDSRLRLWDIDSGCNT
LVNFEAMRLQTGKPLQLAVTEDPSLVFVPCMASIKAYNLWSGKTFQTFRGHYELVNCCYY
SEQDQELYTGSNDRQILVWSPSTPAFTKMEDDDKILSAADEDNWSD
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtggctggaagaggtgaggcggagggagcgtggagagcttcgcgctcggcggtttgag
gccgccgcccgagcgtgccgcacggcctcgctcgcgctctccaatcgcaaggagtttgtc
accccacatcacggcgccgtcaactcgctccaggttgatttgacagaggggaggtacctg
ctctccggggcatcggatgggtcggccgctgtgttcgatgtgtggaacgcgaccgaatac
gaaaccgggttcatagcaaagcacaggaacatactgcttgtggacaagcaacaccagaat
ggccacaagttcgccatctcggcggccgtttggtatcctgtggatacggggctgtttgtc
acagcatcctttgaccagtttgtcaaagtttgggatacaaattcgactcaagtcgtcatg
gaatttaagatgcctggaaaagtgtacactgcagccatgtctccaatcgcaacaacgcac
gtgctcattgctactgggagtgcagatgttcaggtccgtctatgtgacattgcttctgga
gcctttacccacacgttgtctggtcatcgtgatggtatcatgtctttggagtggtctgcc
tcaagtgagtggattttgatgagtggtggctgtgacggggcaatacgtttttgggacatt
agaagagctggatgctttcgggttctggaccaatcaaggtctcaacttggaaaaaggccc
cttgttaaaagtgctctatataagccaaactgcccaaacataaggaagtttggctcaatt
cggattcggacccagaattgcatccaggatcacacagattccttaggaccttcaccttcc
gcaaggagaaggacaggcatttctaagaagagttcatcagctttgcgcaaaattcaaaac
ccgacacatggacacatgcaacagagattgcatcctggtttgtcatctagtcaaaaccgt
gctactgctcattatggtgctgttactggtttacgaacaactgcagatgggatgtacctt
cttagctcaggatctgattctcgcttaagactatgggacatcgattcaggctgcaatacg
ctggtcaattttgaagctatgcgattgcagacaggcaagccattacaattagctgtcact
gaggatccttcacttgtatttgttccatgtatggcaagcatcaaggcatacaatttatgg
tctggtaaaacatttcaaacattccgggggcactatgaacttgtgaattgctgctactat
agtgaacaggaccaagaactttatactggcagcaacgacaggcaaattcttgtgtggtct
ccatcaactccagcttttactaaaatggaagatgatgacaagatcctttctgcagctgat
gaggataactggagcgactga

DBGET integrated database retrieval system