KEGG   Zea mays (maize): 100276170Help
Entry
100276170         CDS       T01088                                 

Gene name
cl14808_1
Definition
LOC100276170
Orthology
K15422  
3'(2'), 5'-bisphosphate nucleotidase / inositol polyphosphate 1-phosphatase [EC:3.1.3.7 3.1.3.57]
Organism
zma  Zea mays (maize)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100276170 (cl14808_1)
  Energy metabolism
   00920 Sulfur metabolism
    100276170 (cl14808_1)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    100276170 (cl14808_1)
Enzymes [BR:zma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     100276170 (cl14808_1)
    3.1.3.57  inositol-1,4-bisphosphate 1-phosphatase
     100276170 (cl14808_1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 354 aa AA seqDB search
MSQATEVVGNPYAAELAAAKKAVALAARLCQRVQRSILHSDIQSKADKTPVTVADYGSQV
LVCLVLKKELPSHSFSIIAEEDSKDLREDGAQEIIEHITTLINETIVNDGSYNMSLSKED
VLSAIDGGKSEGGPSGRHWILDPIDGTKGFIRGDQYAVALGLLDEGKVVLGVLGCPNLPL
KSTNKNNSSSFGDRIGSLFFATIGCGAQVEALEGSEPQKISVCSTNNPVDASFFESFEAS
HSKRDLTSSIAEKLGVRAPPVRMDSQAKYGALARGDGAIFLRIPHKSYIETVWDHAAGSI
IVTEAGGMVKDAAGNDLDFCKGRYLDRDRGIIATNKHLMPLVLKAVQEAMKEEQ
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaggctacggaggtcgtcggaaacccgtacgccgccgagctcgctgcagccaag
aaggccgtcgccctagcggcccgcctctgccagagagtgcagcggagcattttgcactct
gacattcaatcgaaggcagacaagactcctgttacagttgcggattatggatcacaggta
ctggtatgtctggtcctgaagaaggaattgccttctcactctttctcaatcatagctgaa
gaggattcaaaagacttgagagaagatggtgcccaagaaattatagaacacattaccacc
ctcattaatgaaaccatcgtaaatgatggttcatacaacatgtcgttatctaaggaagat
gtgctttctgcaattgatggtggtaaatctgagggaggtccatctgggcgacattggata
ttagacccaatagatggcactaaaggtttcataaggggagatcagtatgcagttgcactt
ggactacttgatgagggcaaagttgttctgggtgtgttgggatgtccaaatcttccatta
aaatcaacaaacaagaacaatagcagctcttttggggatcgaataggttccctctttttt
gctacaattggttgtggagcgcaagttgaggccttagaaggatctgagccacaaaagatt
agtgtttgctccaccaataatccagttgacgcctcattctttgaatcctttgaagcatca
cactccaagcgtgatttaactagctccattgcagagaaacttggtgtccgagctcctcct
gttagaatggatagccaagcaaaatatggtgccctagcacgtggtgatggtgccattttt
ctgcgcatcccgcacaaaagttacatagaaacagtttgggatcatgcagctggatcaatt
attgtcacagaagctggtggcatggtaaaagatgccgcaggaaacgatttggatttttgc
aaaggtagatatcttgatcgtgacagaggaattattgcaacaaacaagcatttaatgcca
ctagttctaaaggcggttcaagaggctatgaaggaggaacagtag

DBGET integrated database retrieval system