KEGG   Zea mays (maize): 100276617Help
Entry
100276617         CDS       T01088                                 

Gene name
pco095363
Definition
LOC100276617
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
zma  Zea mays (maize)
Brite
Enzymes [BR:zma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100276617 (pco095363)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 439 aa AA seqDB search
MDASAGGGGNSLPTTGADGSKRRVFYFYDAEVGNYYYGQGHPMKPHRIRMTHALLGRYGL
LDQMQVFRPHPARDRDLCRFHADDYVSFLRSVTPETQQDQIRALKRFNVGEDCPVFDGLY
SFCQTYAGGSVGGAVKLNHGHDIAINWAGGLHHAKKCEASGFCYVNDIVLAILELLKYHQ
RVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKFGDYFPGTGDIRDVGHSKGKYYSLNVPL
DDGIDDESYQSLFKPIMGKVMEVFNPGAVVLQCGADSLSGDRLGCFNLSIKGHAECVRFM
RSFNVPLLLLGGGGYTIRNVARCWCYETGVALGHELTDKMPPNEYYEYFGPDYTLHVAPS
NMENKNTRHQLDDIKSKLLDNLSKLRHAPSVQFQERSPEAELPEQDEDKENPDERHDADS
DVEMNDAKPLQDSGRMSIV
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgtcggccggcggcggcggcaactccctgccgaccactggcgcggacgggtcg
aagcgccgcgtcttctacttctacgacgcggaggtgggcaactactactacgggcagggc
cacccgatgaagccgcaccgcatccgcatgacccacgcgctgctcggccgctacggcctc
ctcgaccagatgcaagtgttccgccctcaccctgcccgcgaccgcgacctctgccgcttc
cacgccgacgattacgtctccttcctccggtccgtcacccccgaaacgcagcaggaccag
atccgcgcgctcaagcgcttcaacgtcggcgaggactgccccgtcttcgacggtctctac
agtttctgtcagacgtacgcggggggctctgttggcggcgccgtcaagctcaaccatggc
catgatatcgccatcaactgggccggcggactccaccacgccaagaagtgcgaggcctcc
gggttttgctatgttaatgacattgtcctcgccatcctcgagctcctcaagtaccaccag
cgcgttctgtacgtggacattgatatccaccacggggacggcgtggaggaggctttttat
accacagaccgggtgatgacagtctcattccacaagtttggagattatttccctgggaca
ggggacattcgtgatgttgggcactcaaagggtaaatattactccctgaatgttcccctg
gacgatggtattgatgatgagagctaccagtcgttgttcaagccaataatgggcaaggtg
atggaggtcttcaaccctggtgcagtcgtgctccagtgtggtgcggattcattgtcgggt
gacaggttgggctgtttcaacctctctattaagggtcacgcagaatgtgtaagatttatg
aggtccttcaacgtcccgctgttgctgcttggtggtggtgggtataccataagaaacgtt
gcacggtgttggtgctacgagacaggagttgcccttggtcatgagctcactgacaagatg
ccacctaatgagtactatgagtattttggtccagattacactctacatgtcgctccaagt
aacatggagaataaaaacacacggcatcaattggatgacataaaatcaaaacttctagat
aatctttcaaaactccgacatgctcctagtgttcagtttcaagagcgatctcctgaggct
gagttacctgagcaagatgaagacaaagagaatcctgatgaaagacatgatgctgattct
gatgtggagatgaatgatgccaaacctttgcaggactctggaaggatgtcaatagtgtag

DBGET integrated database retrieval system