KEGG   Zea mays (maize): 100276821Help
Entry
100276821         CDS       T01088                                 

Gene name
chi1
Definition
chalcone flavanone isomerase1
Orthology
K01859  
chalcone isomerase [EC:5.5.1.6]
Organism
zma  Zea mays (maize)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Biosynthesis of other secondary metabolites; Flavonoid biosynthesis [PATH:zma00941]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 231 aa AA seqDB search
MAVPEVVVDGVVFPPVARPPGSAGSHFLGGAGVRGVEIGGNFIKFTAIXVYLEDAAVPAL
AKKWGGKTADELASDAAFFRDVVTGDFEKFTRVTMILPLTGEQYAEKVTENCVAFWKAAG
LYTDAEGVAVEKFREVFKPETFAPGASILFTHSPAGVLTVAFSKDSSVPAAGGVAIENKR
LCEAVLESIIGERGVSPAAKLSLAARVSELLAKETAAAADAPQAEPVSITA
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgccggaggtggtggtcgacggcgtcgtcttcccgccggtggcccgcccgccg
ggctccgccggctcgcacttcctcggcggcgcaggcgtgcgaggcgtcgagatcggaggc
aacttcatcaagttcacggccatcrgcgtgtacctggaggacgcggccgtgcccgcgctg
gccaagaagtggggcggcaagacggccgacgagctcgcctccgacgccgccttcttccgc
gacgtcgtcacgggcgacttcgagaagttcacgagggtgacgatgatcctcccgctgacg
ggcgagcagtacgcggagaaagtgacggagaactgcgtggcgttctggaaggccgccggc
ctgtacacggacgccgagggcgtcgccgtggagaagttcagggaggtgttcaagccagag
actttcgcgccgggcgcctccatcctcttcacgcactcgcccgccggagtcctcaccgtc
gccttctccaaggactcgtcggtgccagcggccggcggcgtggcgatcgagaacaagcgc
ctctgcgaggccgtgctggagtccatcatcggggagcgcggcgtgtcgccggccgcgaag
ctgagcctcgccgcgagggtgtcggagctcctcgccaaggagaccgccgcggccgccgac
gcgccgcaggcggagcccgtctccatcaccgcctga

DBGET integrated database retrieval system