KEGG   Zea mays (maize): 100276821Help
Entry
100276821         CDS       T01088                                 

Gene name
chi1
Definition
chalcone flavanone isomerase1
Orthology
K01859  
chalcone isomerase [EC:5.5.1.6]
Organism
zma  Zea mays (maize)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    100276821 (chi1)
Enzymes [BR:zma01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.6  chalcone isomerase
     100276821 (chi1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 231 aa AA seqDB search
MAVPEVVVDGVVFPPVARPPGSAGSHFLGGAGVRGVEIGGNFIKFTAIXVYLEDAAVPAL
AKKWGGKTADELASDAAFFRDVVTGDFEKFTRVTMILPLTGEQYAEKVTENCVAFWKAAG
LYTDAEGVAVEKFREVFKPETFAPGASILFTHSPAGVLTVAFSKDSSVPAAGGVAIENKR
LCEAVLESIIGERGVSPAAKLSLAARVSELLAKETAAAADAPQAEPVSITA
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgccggaggtggtggtcgacggcgtcgtcttcccgccggtggcccgcccgccg
ggctccgccggctcgcacttcctcggcggcgcaggcgtgcgaggcgtcgagatcggaggc
aacttcatcaagttcacggccatcrgcgtgtacctggaggacgcggccgtgcccgcgctg
gccaagaagtggggcggcaagacggccgacgagctcgcctccgacgccgccttcttccgc
gacgtcgtcacgggcgacttcgagaagttcacgagggtgacgatgatcctcccgctgacg
ggcgagcagtacgcggagaaagtgacggagaactgcgtggcgttctggaaggccgccggc
ctgtacacggacgccgagggcgtcgccgtggagaagttcagggaggtgttcaagccagag
actttcgcgccgggcgcctccatcctcttcacgcactcgcccgccggagtcctcaccgtc
gccttctccaaggactcgtcggtgccagcggccggcggcgtggcgatcgagaacaagcgc
ctctgcgaggccgtgctggagtccatcatcggggagcgcggcgtgtcgccggccgcgaag
ctgagcctcgccgcgagggtgtcggagctcctcgccaaggagaccgccgcggccgccgac
gcgccgcaggcggagcccgtctccatcaccgcctga

DBGET integrated database retrieval system