KEGG   Zea mays (maize): 100279194Help
Entry
100279194         CDS       T01088                                 

Gene name
pco084078
Definition
LOC100279194
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
zma  Zea mays (maize)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:zma01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:zma00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:zma00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:zma00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 577 aa AA seqDB search
MLQRCDRNIESGNGDKVAMYWEGNEPGQDGKLTYSELLEKVCQLANYLKSLGVGKGDAVI
IYLPMLLELPIAMLACARIGAVHSVVFAGFSADSLAQRIVDCKPKLVITCNAVKRGVKPI
FLKDIVDAALVESEKNGVSVGLCLTYENQSAMKRENTKWQAERDVWWQDVVTKFPTKCDV
EWVDAEDPLFLLYTSGSTGKPKGVLHTSGGYMVYTATTFKYAFDYKPTDIYWCTADCGWI
TGHSYVTYGPLLNGATVLVFEGTPNYPDSGRCWDIVDKYNVTIFYTAPTLVRSLMRDGTE
YVTRYSRKSLRVLGSVGEPINPSAWRWFYNTVGDSRCPISDTWWQTETGGFMITPLPGAW
PQKPGSATFPFFGVQPVIVDEKGQEIEGECSGYLCIKKSWPGAFRTLYGDHERYETTYFK
PFAGYYFTGDGCSRDKDGYHWLTGRVDDVINVSGHRIGTAEVESALVSHPQCAEAAVVGV
EHEVKGQGIYAFVTLVDGVPYSEELRKSLIMTVRNQIGAFAAPDKIHWAPGLPKTRSGKI
MRRILRKIAARQLDELGDISTLAEPAVVDQLISLSNC
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgttacaacgctgtgaccgcaacatcgagtctggcaatggcgacaaggttgcaatgtac
tgggagggtaatgagcccggtcaggatgggaagcttacctattccgagctcctggagaag
gtttgccagcttgcaaattacttgaagagccttggtgtcggcaagggtgatgctgttatt
atatacctaccaatgttgctggagcttcccattgccatgcttgcctgtgcccgcattggt
gccgttcactcggttgtgtttgctggcttctcagcagattcgctagctcaaaggattgtc
gattgtaagcctaagcttgtcatcacgtgcaatgctgtgaagcggggagtcaagcccatc
tttctcaaagatatagtggatgcagctttggttgaaagtgagaagaatggagtctctgta
ggtctctgtttgacgtatgaaaaccagtcagccatgaagagggaaaacacaaaatggcaa
gcagaaagggatgtttggtggcaggacgttgtcacaaaatttccaaccaaatgtgatgtg
gagtgggtggatgcagaggatccattgttccttttgtacacaagtggcagcacagggaag
ccaaagggtgtactgcatacttctgggggctacatggtgtacactgcaacaacatttaag
tacgcatttgactacaagccaactgacatatactggtgcactgcagactgtggctggatt
actggacatagttatgtaacatatggtcctctcctgaatggtgctacggttctcgttttt
gaagggacgccgaactaccctgattcgggccgatgctgggatattgtggacaagtacaat
gtgacaatattttatactgccccaactcttgttcgttcactcatgcgtgatggcactgag
tatgttacacgttactctcgaaagtctctccgagtcctgggaagtgttggtgagccaatc
aatcctagtgcatggagatggttctacaatactgttggggattcccggtgccctatatca
gacacctggtggcaaactgaaactggcggtttcatgatcacccctttgcctggcgcctgg
cctcaaaaaccaggttctgcaacctttcctttctttggtgttcagccggtcattgttgac
gagaaagggcaagagattgaaggggaatgtagtggatatctttgcataaagaaatcatgg
cctggggctttccggactctgtatggagatcatgagagatacgagaccacgtacttcaaa
ccatttgctgggtactatttcactggtgatggttgcagcagagacaaagatggttaccac
tggctgactggaagagtagatgatgtcatcaatgtcagtggacaccgaatcggcacagca
gaggttgagtcagctttagtgtcacatccacagtgtgcagaggctgctgttgttggtgtt
gagcatgaggtcaaaggtcaaggaatttatgcttttgtaactttggtggatggtgttccg
tatagtgaggaactacgaaaaagcctcataatgacagtgcgcaaccagattggggcattt
gcagctcctgacaagatccactgggcaccgggacttcctaaaacccggagtggcaagatc
atgcgaaggattttgcgcaagattgctgcacggcaactggatgaacttggggacataagc
accctcgctgaacctgctgtagttgaccagcttatttcgctcagcaattgttag

DBGET integrated database retrieval system