KEGG   Zea mays (maize): 100279194Help
Entry
100279194         CDS       T01088                                 

Gene name
pco084078
Definition
LOC100279194
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
zma  Zea mays (maize)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100279194 (pco084078)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100279194 (pco084078)
   00620 Pyruvate metabolism
    100279194 (pco084078)
   00640 Propanoate metabolism
    100279194 (pco084078)
Enzymes [BR:zma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     100279194 (pco084078)
Lipid biosynthesis proteins [BR:zma01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   100279194 (pco084078)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 577 aa AA seqDB search
MLQRCDRNIESGNGDKVAMYWEGNEPGQDGKLTYSELLEKVCQLANYLKSLGVGKGDAVI
IYLPMLLELPIAMLACARIGAVHSVVFAGFSADSLAQRIVDCKPKLVITCNAVKRGVKPI
FLKDIVDAALVESEKNGVSVGLCLTYENQSAMKRENTKWQAERDVWWQDVVTKFPTKCDV
EWVDAEDPLFLLYTSGSTGKPKGVLHTSGGYMVYTATTFKYAFDYKPTDIYWCTADCGWI
TGHSYVTYGPLLNGATVLVFEGTPNYPDSGRCWDIVDKYNVTIFYTAPTLVRSLMRDGTE
YVTRYSRKSLRVLGSVGEPINPSAWRWFYNTVGDSRCPISDTWWQTETGGFMITPLPGAW
PQKPGSATFPFFGVQPVIVDEKGQEIEGECSGYLCIKKSWPGAFRTLYGDHERYETTYFK
PFAGYYFTGDGCSRDKDGYHWLTGRVDDVINVSGHRIGTAEVESALVSHPQCAEAAVVGV
EHEVKGQGIYAFVTLVDGVPYSEELRKSLIMTVRNQIGAFAAPDKIHWAPGLPKTRSGKI
MRRILRKIAARQLDELGDISTLAEPAVVDQLISLSNC
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgttacaacgctgtgaccgcaacatcgagtctggcaatggcgacaaggttgcaatgtac
tgggagggtaatgagcccggtcaggatgggaagcttacctattccgagctcctggagaag
gtttgccagcttgcaaattacttgaagagccttggtgtcggcaagggtgatgctgttatt
atatacctaccaatgttgctggagcttcccattgccatgcttgcctgtgcccgcattggt
gccgttcactcggttgtgtttgctggcttctcagcagattcgctagctcaaaggattgtc
gattgtaagcctaagcttgtcatcacgtgcaatgctgtgaagcggggagtcaagcccatc
tttctcaaagatatagtggatgcagctttggttgaaagtgagaagaatggagtctctgta
ggtctctgtttgacgtatgaaaaccagtcagccatgaagagggaaaacacaaaatggcaa
gcagaaagggatgtttggtggcaggacgttgtcacaaaatttccaaccaaatgtgatgtg
gagtgggtggatgcagaggatccattgttccttttgtacacaagtggcagcacagggaag
ccaaagggtgtactgcatacttctgggggctacatggtgtacactgcaacaacatttaag
tacgcatttgactacaagccaactgacatatactggtgcactgcagactgtggctggatt
actggacatagttatgtaacatatggtcctctcctgaatggtgctacggttctcgttttt
gaagggacgccgaactaccctgattcgggccgatgctgggatattgtggacaagtacaat
gtgacaatattttatactgccccaactcttgttcgttcactcatgcgtgatggcactgag
tatgttacacgttactctcgaaagtctctccgagtcctgggaagtgttggtgagccaatc
aatcctagtgcatggagatggttctacaatactgttggggattcccggtgccctatatca
gacacctggtggcaaactgaaactggcggtttcatgatcacccctttgcctggcgcctgg
cctcaaaaaccaggttctgcaacctttcctttctttggtgttcagccggtcattgttgac
gagaaagggcaagagattgaaggggaatgtagtggatatctttgcataaagaaatcatgg
cctggggctttccggactctgtatggagatcatgagagatacgagaccacgtacttcaaa
ccatttgctgggtactatttcactggtgatggttgcagcagagacaaagatggttaccac
tggctgactggaagagtagatgatgtcatcaatgtcagtggacaccgaatcggcacagca
gaggttgagtcagctttagtgtcacatccacagtgtgcagaggctgctgttgttggtgtt
gagcatgaggtcaaaggtcaaggaatttatgcttttgtaactttggtggatggtgttccg
tatagtgaggaactacgaaaaagcctcataatgacagtgcgcaaccagattggggcattt
gcagctcctgacaagatccactgggcaccgggacttcctaaaacccggagtggcaagatc
atgcgaaggattttgcgcaagattgctgcacggcaactggatgaacttggggacataagc
accctcgctgaacctgctgtagttgaccagcttatttcgctcagcaattgttag

DBGET integrated database retrieval system