KEGG   Zea mays (maize): 100279221Help
Entry
100279221         CDS       T01088                                 

Definition
uncharacterized LOC100279221
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
zma  Zea mays (maize)
Brite
Enzymes [BR:zma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100279221
Protein kinases [BR:zma01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   100279221
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 308 aa AA seqDB search
MCIYAADCSEIGLVQVRGYDKMRTLKRFYIKRVQDLHKEVQVFEEKDLMKSLSKSTCVPE
VLSTCADQSYLGILLNCCLCCSLASILHTPLNETSARFFAASVVVALEELHQKSIIYRGV
SADILMLDRSGHLQLVDFRFAKKLEGQRTYTICGIADSLAPEIVLGRGHGFPADWWALGV
LIYFMLQSDMPFGSWRESELEPITKIAKGHLVMPVSFSAEVVDLITKLLVVDENARLGTS
GAEAVKKHPWFDGTDWERIASGTCAAPEEITERINYCIETLNEDLSASPSVPIEDPDDLT
APEWIQDW
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgtgcatatatgctgctgattgcagtgagattggtcttgtccaagtcaggggctatgac
aagatgagaactttaaaaaggttttacatcaagagagtacaagatctccataaggaagta
caagtatttgaggaaaaggaccttatgaaaagcttgagcaaatcaacttgcgtgccagaa
gttctgtctacttgtgctgatcagtcataccttggaatattactgaattgttgcctttgt
tgctcactggcttcaatacttcatacaccactaaatgagacatctgcaagattctttgca
gcctcagttgttgttgctctagaagaacttcatcagaagtccattatctatagaggtgtt
tcggcagacattcttatgctcgacagatcaggacatctgcagctggtggattttaggttt
gcaaagaagttggaaggtcaaaggacatacacaatatgtgggatcgctgactctctggca
ccagagattgttcttggtaggggtcatggatttcctgctgactggtgggcacttggagtt
ttgatctatttcatgcttcagtcagacatgccattcgggtcctggagggagagcgagctg
gaacctattacaaaaattgccaaaggccaccttgttatgccagtgtctttcagtgcagaa
gttgttgaccttataaccaagctactcgtggtcgacgaaaacgcgcgccttggaaccagt
ggtgctgaagctgtgaagaaacacccctggtttgatggcactgattgggagcgaatagca
tctgggacttgtgcagcacctgaagaaatcactgagcgcatcaactactgtatagaaact
cttaatgaggacttatccgcatctccttccgtgccgattgaagacccagatgatctcact
gctccagagtggatccaggattggtga

DBGET integrated database retrieval system