KEGG   Zea mays (maize): 100279221Help
Entry
100279221         CDS       T01088                                 

Definition
(RefSeq) uncharacterized LOC100279221
Organism
zma  Zea mays (maize)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 1084 aa AA seqDB search
MGCSASKCCSQLKCSLCSNGCLGQAPDSPRESRGKSSRGRGRVDSSGSDDSSGDDLGEDD
DAFNHMNATRESTAGISRLSRVSSQFLPPDASRKVQVPLGNYDLRYSFLSQRGYYPESLD
KANQDSYCVHTPFGPSPDDHLFGVFDGHGEYGAQCSQFVKRRLCENLLRDNRFRTDAVLA
LHSAFVATNTQLHADNLDDSMSGTTAVTILVRGKTIYVANTGDSRAVIAEKQGDDIVAVD
LSIDQTPYRFDELERVKECGARVLTLDQIEGLKNPDVQCWGTEESDDGDPPRLWVQNGMY
PGTAFTRSIGDSVAESIGVIADPEIFVLDLNSNNPFFVLASDGVFEFLSSQTVVDMVSKY
KDPRDACAEIVAESYRLWLQYETRTDDITIILVHINGLTDKESTQTVTKVTLQPSQQVVG
LAGPESPLIVSSNTNNQRSKHDLSRARLRALESSLENGQLWVPPSPSHRKTWEEQAHIER
VLHDHFLFRKLTDSQCHVLLDCMQRVEVKPRDIVVQQGGEGDCFYVVGSGEYEVLAIQEE
NGKEITKVLHRYTADKLSSFGELALMHNKPLQASVRAVTSGTLWALKREDFRGILMSEFS
NIPSLKLLRSVQLFTRFTVLQLSQLAESLVEVSFADGQIIVDKNDKFSSLYIIQRGRVRL
ILATDQMTSDTWDLISAETKQAQSSRENGNYVLDIDEGGHFGEWSLIGETIAFTAIAVGD
VTCSTIMKEKFDSIVGPFPKLSQADSKIKESLVTLENVADGDFPFRRVKLSDLEWKMCIY
AADCSEIGLVQVRGYDKMRTLKRFYIKRVQDLHKEVQVFEEKDLMKSLSKSTCVPEVLST
CADQSYLGILLNCCLCCSLASILHTPLNETSARFFAASVVVALEELHQKSIIYRGVSADI
LMLDRSGHLQLVDFRFAKKLEGQRTYTICGIADSLAPEIVLGRGHGFPADWWALGVLIYF
MLQSDMPFGSWRESELEPITKIAKGHLVMPVSFSAEVVDLITKLLVVDENARLGTSGAEA
VKKHPWFDGTDWERIASGTCAAPEEITERINYCIETLNEDLSASPSVPIEDPDDLTAPEW
IQDW
NT seq 3255 nt NT seq  +upstreamnt  +downstreamnt
atgggctgttcagcttccaagtgttgttcacaattgaagtgctctttgtgctcaaatggg
tgcctggggcaggcacctgactccccgagggaatccaggggaaagtcaagtcgggggaga
gggagggtagattctagtggttcagatgattcttctggtgatgatctcggggaagatgac
gatgcttttaaccatatgaatgctacaagggaatcaactgctggcatcagccgactgtca
agggtgtcgtcacagtttcttcctcccgatgcttcacgcaaggttcaggtccctttgggt
aactatgacctgagatactccttcctgtctcaaagaggttactacccagaatcactggac
aaggcaaatcaagatagctactgcgtacataccccatttggacctagtcctgatgaccac
ttattcggtgtgtttgatggccatggggaatatggagctcaatgctcgcaatttgtgaag
cgaagattatgcgagaacctgctcagagataacaggtttcgtaccgatgctgtgctggct
cttcattctgcttttgtggcaacgaacacacagctgcatgccgacaacttggatgactcc
atgagtggtactactgcagtcactatcttggtcaggggtaaaactatttacgttgcaaat
accggtgattcgcgtgctgttatcgccgaaaaacaaggggatgacattgtcgctgttgac
ctttccatagatcaaaccccttaccggtttgatgagcttgaaagggtcaaggaatgtggt
gctagggttctaacgttggaccaaatagagggcctaaagaacccagatgtgcagtgttgg
ggtactgaagaaagtgacgatggcgatcctccaaggttatgggtgcaaaatggcatgtac
ccaggaactgcttttacccgtagcattggagattctgttgctgagtcaattggtgtcatt
gcagatcccgagatttttgtcctggatctcaattccaacaatccatttttcgttcttgct
agcgatggcgtttttgagttcctttccagtcaaacagttgtcgacatggtttctaaatac
aaggatcctcgagatgcatgtgcagaaattgtcgctgagtcctatcgtctttggctacag
tatgaaactcgtacagatgacattacaatcatactcgtgcatattaatgggttaactgat
aaggaatctacccagactgttacgaaggtgactttacaaccttcacaacaagtagtagga
ctggcaggccctgaatcgccactaatagtaagttccaacaccaataatcagcgctccaag
catgatttatcacgggcacgattgagggctcttgaaagttctctagagaatggtcaatta
tgggtccctccatctccatcgcatcggaagacatgggaagagcaagcgcatattgagcgg
gtactacatgatcatttcctatttaggaagcttactgactcacaatgtcatgttctactt
gattgtatgcaacgagttgaggtgaaacctagggatatagtagtacaacagggcggtgaa
ggtgactgcttctatgtagttggtagtggtgagtatgaagttctggctattcaggaagaa
aatggaaaggaaataaccaaggttctgcatcggtatacagctgacaagttatcttctttt
ggggagctagcactaatgcacaataagccgcttcaggcttcagttcgtgctgtgaccagt
ggaacattatgggctctaaagagggaggacttccggggtattttgatgtcagaattttca
aacataccatcattgaagttgctccgatctgtacaactgtttacaagatttacagtgctt
caactaagtcaacttgccgagtcacttgttgaagtatcttttgcagatgggcaaataata
gtagataagaatgataaattctcttctctgtatatcattcaaagaggtcgtgtgagactt
atattggctactgatcaaatgacttcagatacttgggatctcattagtgctgaaacaaag
caggcacaaagtagtcgggaaaatggtaattatgtgcttgatatagatgagggagggcac
ttcggagagtggtctctcattggtgagactattgctttcactgctattgctgttggtgat
gttacttgttctactatcatgaaggagaaatttgactcaattgttgggccttttcctaaa
ctttcgcaagctgattccaagattaaagaatctctggtaactctggagaatgttgcagat
ggtgatttcccttttaggagggtgaagctctcagatttggaatggaaaatgtgcatatat
gctgctgattgcagtgagattggtcttgtccaagtcaggggctatgacaagatgagaact
ttaaaaaggttttacatcaagagagtacaagatctccataaggaagtacaagtatttgag
gaaaaggaccttatgaaaagcttgagcaaatcaacttgcgtgccagaagttctgtctact
tgtgctgatcagtcataccttggaatattactgaattgttgcctttgttgctcactggct
tcaatacttcatacaccactaaatgagacatctgcaagattctttgcagcctcagttgtt
gttgctctagaagaacttcatcagaagtccattatctatagaggtgtttcggcagacatt
cttatgctcgacagatcaggacatctgcagctggtggattttaggtttgcaaagaagttg
gaaggtcaaaggacatacacaatatgtgggatcgctgactctctggcaccagagattgtt
cttggtaggggtcatggatttcctgctgactggtgggcacttggagttttgatctatttc
atgcttcagtcagacatgccattcgggtcctggagggagagcgagctggaacctattaca
aaaattgccaaaggccaccttgttatgccagtgtctttcagtgcagaagttgttgacctt
ataaccaagctactcgtggtcgacgaaaacgcgcgccttggaaccagtggtgctgaagct
gtgaagaaacacccctggtttgatggcactgattgggagcgaatagcatctgggacttgt
gcagcacctgaagaaatcactgagcgcatcaactactgtatagaaactcttaatgaggac
ttatccgcatctccttccgtgccgattgaagacccagatgatctcactgctccagagtgg
atccaggattggtga

DBGET integrated database retrieval system