KEGG   Zea mays (maize): 100279231Help
Entry
100279231         CDS       T01088                                 

Gene name
GRMZM2G139360
Definition
(RefSeq) uncharacterized LOC100279231
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
zma  Zea mays (maize)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100279231 (GRMZM2G139360)
   01230 Biosynthesis of amino acids
    100279231 (GRMZM2G139360)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100279231 (GRMZM2G139360)
   00030 Pentose phosphate pathway
    100279231 (GRMZM2G139360)
   00051 Fructose and mannose metabolism
    100279231 (GRMZM2G139360)
   00052 Galactose metabolism
    100279231 (GRMZM2G139360)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    100279231 (GRMZM2G139360)
Enzymes [BR:zma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100279231 (GRMZM2G139360)
Protein phosphatases and associated proteins [BR:zma01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100279231 (GRMZM2G139360)
Messenger RNA biogenesis [BR:zma03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100279231 (GRMZM2G139360)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 527 aa AA seqDB search
MMAAVLKTSGSFCSTQQQHFQQSRRDQFLHGSYSNFKHCKSKKIIKPAPLCARVTSSKVE
LDVKDPYWKQKFQEDWESRFDLPSITDIYDLKPRPTTFSLKKNRTLTGDENVDMWNGYVN
NDDRALLKVIKYSSPTSAGAECVDLDCSWVEQWVHRAGPRKEIYYEPEEVKAAIVTCGGL
CPGLNDVIRQIVFTLETYGVKNIVGIPFGYRGFFEKGLKEMPLSRGLVENINLNGGSFLG
VSRGGAKTSEIVDSIQARRIDMLFVLGGNGTHAGANAIHEECRKRKLKVSVVAVPKTIDN
DILLMDKTFGFDTAVEEAQRAINSAYIEARSAYHGIGLVKLMGRSSGFIAMHASLSSGQV
DVCLIPEVPFTLDGEFGVLRQLEHLLKSKGFCVVCVAEAAGQDLLQESGATDASGNVILS
DIGVHMQQKIKMHFKDIGVPADVKYIDPTYMVRACRANASDAILCTVLGQNAVHGAFAGF
SGITSCICNTHYVYLPITEVITAPKRVNPNSRMWHRCLTSTGQPDFH
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgatggctgctgttttaaaaacaagtggcagtttttgtagtacacaacagcagcatttt
cagcaatcaagaagggatcagtttttgcatggttcttattcaaatttcaaacattgcaaa
agcaagaagataataaagcctgctccactgtgtgctagagtgacttcctcgaaagtggaa
ctagatgttaaggatccatattggaagcagaagtttcaggaagactgggaaagccggttt
gatttgccaagtattactgatatatatgatctgaaaccaaggccgactacattctcactc
aagaaaaacagaactcttacaggtgatgaaaatgtggatatgtggaatggttatgttaac
aatgatgatcgggcacttttgaaggtgataaagtattcatcgcctacttctgctggagca
gagtgtgttgatcttgactgtagctgggtggagcaatgggtgcatcgagcaggaccacgc
aaggagatatactatgagccagaggaagtaaaagctgctatagttacctgtggaggtcta
tgtcctggtttgaatgatgtcatcagacagatagtattcaccctagagacctatggtgtt
aagaatattgttggaattccatttggttatcgtggatttttcgaaaagggcctcaaagaa
atgccgctttcacgtggtctagtggagaatataaatcttaatggtggaagttttcttggt
gtttctcgcggtggagctaaaactagtgagattgttgatagtatacaggccagaaggatt
gacatgctttttgtacttggtggaaatggtacgcatgcaggagcaaatgctatccatgaa
gagtgccgtaagagaaagctgaaggtttcagttgtagcagttccaaaaacaatcgacaat
gatatacttttgatggataaaacatttggttttgatacagctgttgaagaagcccaacga
gccattaattccgcatatatagaggcacgtagtgcttaccatggtattggcttggtcaaa
ttaatgggaagaagcagcgggtttattgcaatgcacgcttccctttcaagtgggcaggtc
gatgtctgcttaatacctgaggtcccgttcactctagatggagaatttggtgttttgcgg
caacttgagcatttgctaaagagtaagggattttgtgtggtttgtgttgcagaagctgct
ggacaagatctactccaagaatcaggtgcgactgatgcatcaggaaatgtgatattgagt
gacattggtgttcacatgcaacagaagattaagatgcatttcaaggacattggtgttcca
gctgacgtgaaatacatcgatccaacttacatggttcgtgcatgccgtgccaacgcatct
gatgcaattttgtgtaccgtgctcggacaaaatgctgtccatggggcatttgctggtttc
agcggcatcacttcttgcatctgcaacacgcactacgtgtaccttcccatcacggaggtc
atcacagcaccgaagcgcgtgaacccgaacagcaggatgtggcatcggtgtctcacgtcc
actggtcagcctgacttccactga

DBGET integrated database retrieval system