KEGG   Zea mays (maize): 100279839Help
Entry
100279839         CDS       T01088                                 

Definition
hypothetical protein
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
zma  Zea mays (maize)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:zma00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 365 aa AA seqDB search
MAPKESQQQQSPAEVAAPAARSIPDEARRLLHELAAAWEDVAGCGSREPEVVPLKGAMTN
EVYRARWATGSGDSSAPGQSDARTVLVRVYGEGVDLFFDREDEVRTFEFMSRHGHGPRLL
GRFPNGRVEEFIHARTLSAPDLRDPGISAIIASKLREFHSLDMPGSKSVLIWERLRNWLR
TAKSLYSSSDETEEFCLDSMEEEIAALENEFSGECERVGFCHNDLQYGNIMIDEETRLLT
IIDYEYAGFNPVAYDIANHFCEMAADYHSEKPHILDYSKYPDTDERKQFVRTYLSSSGEE
SEEEVENLIKSIEKYTLASHLVWGLWGIISDHVNDIDFDYKDYARQRFEQYWLKKPTILA
SQTAE
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgaaggagagccagcagcagcagagtccggccgaggtggcggcgccggccgcg
cggagcatcccggacgaggcgcggcggctgctgcacgagctggccgcggcgtgggaggac
gtggccgggtgcgggtcgcgcgagcccgaggtggtgccgctcaagggcgccatgaccaac
gaggtgtaccgggcgcggtgggccaccggcagcggggactcgtcggcgccggggcagagt
gacgcgcggacggttctggtgcgggtctacggggagggcgtcgacctgttcttcgacagg
gaggacgaggtgcgcacgttcgagttcatgtcgcggcatggccacggcccccgcctcctc
ggccgcttccccaacggccgcgtcgaggagttcatccatgccaggacactttcagctcct
gacctacgtgatccggggatttcagccatcatagcctccaaactgagggaatttcacagc
ctcgacatgcctggttcaaaatccgtgctcatctgggaaagattaaggaactggctcaga
actgccaagagcctgtactcctcctctgatgaaaccgaagagttctgcttggatagcatg
gaggaggagatcgctgcgctggagaacgagttctcaggggagtgcgagcgcgtaggattt
tgccataacgatctccagtatgggaacatcatgatcgacgaagagacgaggctactgacc
atcattgactacgagtatgcaggttttaacccagttgcttatgacatcgcaaaccatttc
tgtgaaatggccgcagactaccattcagaaaagcctcacatattggactacagcaaatat
ccagataccgatgagcggaagcaatttgtgcggacatacctgagctcctcaggtgaggaa
tctgaagaggaggtagagaacctgatcaaaagcattgagaagtacaccctcgccagccac
ctagtttggggcctatggggaataatttcggatcatgtcaacgatatcgacttcgactat
aaggattacgctaggcagaggttcgagcagtactggctgaagaagccgaccatccttgct
tctcagactgctgaatag

DBGET integrated database retrieval system