KEGG   Zea mays (maize): 100280003Help
Entry
100280003         CDS       T01088                                 

Definition
hypothetical protein
Organism
zma  Zea mays (maize)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 437 aa AA seqDB search
MARIPQVLAPLLLLLLPAGLRELMIDRRPLPEGAAGGEVLLHPLVLVPGLTCSELDARLT
DAYRPSAPRCGAMKGKGWFGLWANCSDLPAHHYVRCFMEQMALVYDPVANDYRNLPGVET
RVRNFGSSQGFQKNPEHTTWSWCFEVLRNELARAGYRDGDTLFGAPYDLRYAPPVPGQPS
EVFSGYFRRLASLVEDASRKNRGRKVILFGHSFGGMVALEFVRSTPMAWRDRYIKHLFLV
APVPAEGFVKPLQYFVSGSNLMYVPTVSSLELAFRPMWRTFESSLVNFPSPAVFGRRPLV
VTARRNYSAYDLEDLLVAVGYGAGVEPFRRRAVPKMSYFQAPMVPTTCMNGVGNDTPEQL
VYWDGDFDATPEIVYGDGDDSINLVSMLAFDEKMRRQPEQNKVYKSIKIRGAQHGTIVTD
DTALKRVMHEILEANRS
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggattccccaggttctggcgccgctcctcctcctgctgctccccgccggtctc
cgggagctgatgatcgaccgccggcccctgccggaaggcgctgccggcggcgaggtcctc
ctccacccgctggtgctggtgcccgggctgacgtgcagcgagctggacgcgcggctcacg
gacgcctaccgcccctccgcgccgcggtgcggcgccatgaaggggaagggctggttcggc
ctctgggccaactgctccgacctgcccgcgcaccactacgtgcggtgcttcatggagcag
atggccctcgtctacgaccccgtcgcgaacgactaccggaacctgcccggcgtcgagacg
cgcgtgcgcaatttcggctcctcccaaggattccagaagaacccagagcacacgacctgg
tcctggtgcttcgaggtcctcagaaacgagctggcaagggccgggtaccgcgacggcgac
accctgttcggggccccgtacgacctccgctacgccccgccggtgcccggccagccatcg
gaggtcttctccggctacttccgtcggctggcgagcctcgtcgaggacgcgagccgcaag
aaccggggcaggaaggtgatcctcttcgggcacagcttcgggggcatggtggcgctggag
ttcgtccggagcactcccatggcgtggcgagacaggtacatcaagcacctcttcctcgtc
gccccggtgccggcggaagggttcgtgaagccgctgcagtacttcgtctccgggtccaac
ctgatgtacgtcccgacagtcagctcgctcgagctggcctttaggccgatgtggcggacc
ttcgagtcctccctcgtcaacttcccctccccggcggtgttcgggcgcaggccgctcgtg
gtcaccgcgcggaggaactactccgcctacgacctggaggacctcctcgtcgccgtcggc
tacggcgccggcgtggagcccttcaggagacgggcggtccccaagatgagctacttccag
gcccccatggtgccgaccacgtgcatgaacggggtgggcaacgacacgccggagcagctc
gtctactgggacggcgatttcgacgcgaccccggagattgtgtacggcgacggggacgat
tccatcaatttggtcagcatgctggcgttcgacgagaagatgcgccggcagccggaacag
aacaaggtgtacaagtcgatcaagattcgtggggcccagcacggtactattgtgacagac
gacacggcgctcaagcgggtcatgcacgaaattcttgaagcgaatcgtagttaa

DBGET integrated database retrieval system