KEGG   Zea mays (maize): 100280060Help
Entry
100280060         CDS       T01088                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
zma  Zea mays (maize)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:zma00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:zma00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 168 aa AA seqDB search
MAAASSATSVHDFTVKDSSGKDVDLSVYRGKVLLIVNVASQCGLTNSNYTQQAQLYEKYK
NQGFEILAFPCNQFGGQEPGTNEEIAQFACTRFKADYPIFDKVDVNGNNAAPIYKFLKSS
KGGLFGDSIKWNFSKFLVDKEGRVVDRYAPTTSPLSIEKDIKKLLGSS
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgcgtcgtccgccacctccgtccacgacttcaccgtcaaggattcgagcggc
aaggacgttgacctcagcgtctacagggggaaggttcttctcatcgttaacgtcgcatcc
caatgtggcttaaccaactccaactacactcagcaggcccagctctatgagaagtacaag
aaccaaggctttgaaatcctcgctttcccgtgcaaccagtttggtgggcaggagcctggt
accaacgaggagattgcccagtttgcctgcacacgcttcaaggctgactaccccatcttt
gacaaggttgatgtcaatggtaacaatgctgcgcccatctacaagtttctgaaatctagc
aagggtggccttttcggcgacagcatcaagtggaacttttccaagttcttggttgacaag
gaggggcgtgttgtggatcgctatgctccaaccacttcacctctgagcattgagaaggat
atcaagaagctgcttgggagctcttaa

DBGET integrated database retrieval system