KEGG   Zea mays (maize): 100280079Help
Entry
100280079         CDS       T01088                                 

Definition
hypothetical protein
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
zma  Zea mays (maize)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:zma00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 526 aa AA seqDB search
MLLHAKDSVRKMHSVAKNYFVSDLTHPPRSLNRASRHVVPFKTRFFTHCSLESRSVDQEI
VIAMGSNVGDRVSTFNRALQLMKSSDVNITRHACLYETAPAYLTDQPRFLNSAIRGTTRL
RPHELLKLLKEIEKDIGRTGGIRYGPRPIDLDILLYGNSQIHSETLIVPHERIHERSFVL
APLVDLLGASSDNGIETSWHSLSKCSGGFFELWNNLGGESIIGTESIKRVLPVGDRLLDW
CERTLVMGVLNLTPDSFSDGGKFLEVGAAISQAKSLISEGADIIDIGAQSTRPFAKRLSP
NEELERLVPVLDEITKIPEMEGKLLSVDTFYAEVASEAVKRGAHMINDVSSGQLDPRILK
VAAELGVPYVAMHMRGDPSTMQSEQNVHYDNVCKEVALELYTQVREAELSGIPLWRLVLD
PGIGFSKKSGHNLEVIMGLESIRREMGKMSIGASHVPILLGPSRKSFLGEICNRANPVER
DVATVAAVTAGILNGANIVRIHNAGYGVDAAKVCDALRKRKGSCRN
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgctcctgcatgctaaggattcagttaggaagatgcattcagttgctaagaactacttt
gtgtctgatcttactcatcctccaagatccttgaacagagcttccagacatgttgttcca
ttcaagacccgtttctttactcattgctcacttgagagccgttcagttgaccaagagatt
gtgattgctatgggaagcaatgtaggcgatagagtcagtacattcaacagggcattgcag
ctgatgaaaagctcagacgtgaacatcactaggcatgcctgtctctatgagaccgcccct
gcttatttgactgatcagccgcggtttcttaactctgccattcggggcacaactaggctc
aggccacatgagcttcttaaactgctaaaggaaattgagaaggatattggccgcactggc
ggaataaggtacggcccaagacctatcgatctagacatacttctttatggtaactcccag
atccatagtgagactctaattgtgccacatgagcgcatccatgagaggtcatttgtttta
gcacctcttgttgaccttctaggtgcatctagtgacaacggtatcgaaacaagttggcac
tctctctcaaagtgtagtggaggtttctttgagttatggaataaccttgggggtgaatct
ataattggaacagaaagcattaaaagggtattacctgttggggatcgtttgttggattgg
tgtgagaggactcttgtcatgggggtccttaatttgacaccagacagctttagtgatgga
ggtaagtttctagaagtgggagctgccatttctcaggctaagtcattaatctcagaaggt
gcagatatcattgatattggtgctcaatctaccaggccctttgcaaaaagattatctcca
aatgaggagcttgagaggttggttcctgttctggatgagattacaaaaatccctgagatg
gagggcaagttactctcagtggatacattctatgcagaagttgccagtgaagctgtgaaa
agaggagctcacatgatcaacgatgtatccagtggacagcttgatccaagaattcttaaa
gtggcagctgaactgggagttccatatgttgcaatgcacatgaggggagatccgtcaact
atgcaaagcgaacaaaatgtacactatgataatgtctgcaaggaagttgctttggagcta
tacacacaggtgagagaagcagagttatctgggattccattgtggaggctggttcttgat
cctggcattggcttctccaagaaatctggacataaccttgaagtaattatgggattggaa
tccattaggagggagatgggtaaaatgagtataggtgcttcacatgtgccaatattactg
ggaccttcaaggaaaagctttttgggtgaaatatgcaatcgtgccaatccagttgagaga
gatgttgctactgttgcagccgtgacagctgggattttgaatggtgctaacattgtaaga
atccataatgctggatatggtgtagacgctgcaaaggtttgtgatgcattgcgtaagcgt
aagggaagttgcagaaactga

DBGET integrated database retrieval system