KEGG   Zea mays (maize): 100280285Help
Entry
100280285         CDS       T01088                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
zma  Zea mays (maize)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:zma00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:zma00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 563 aa AA seqDB search
MPPIPKRGEHLLVLLIVACAATAATAAGTVPFYPSAESAAAAHCDGTLYPELCLSTLADI
PDLHKKPLPDVICAAVNRTEDVVVATSSNCSYYLQDRSLSARDRLAINDCLELLSTTMDE
LRASTADLASPAGRGSASAGVSQGARRATMEHVMTVLSAAITNQYTCLDGFAYQSGGRVR
RYIEPTFHHVSRMVSNSLAMAKKLPGAGASAAPAPPRQPFTGYGQMVKGFPRWVRPGDRR
LLQAPASAVAADAVVAKDGSGDYTTVAAAVAAAPTNSKKRHVIYIKAGAYMENVEVGKKH
VNLMFVGDGIGKTVIKASRNVVDGYTTFRSATVAVVGNNFLARDLTIENSAGPSKHQAVA
LRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRDCDVYGTIDFVFGNAAVVLQGCNLYARK
PLPNQSNIFTAQGREDPNQNTGISIQRCKVAAAADLAAAQSSTKTYLGRPWKQYSRTVYL
QSELDSLVDPAGWLEWNGSFALDTLYYGEYMNTGPGAGTSGRVKWKGYRVITSAAEASAF
TVGNFIDGDLWLAGTSIPFTTGL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgccacccatacccaagagaggcgagcatctcctggtcctcctaattgtcgcatgcgct
gccaccgccgccaccgccgccggcaccgtccccttctacccgtccgcggagtccgccgcc
gccgcgcactgcgacggcacgctgtacccggagctctgcctgtcgacactcgcggacatc
ccggacctacacaagaagccgctcccggacgtcatctgcgcggccgtgaaccgcaccgag
gacgtggtggtcgccacgtccagcaactgctcgtactacctgcaggacaggtccctgtcg
gcgcgggaccgcctggccatcaacgactgcctggagctgctgtccaccacgatggacgag
ctccgcgccagcaccgccgacctggcgtcccccgccggcagggggtcggcgtcggcgggc
gtgtcgcagggcgccaggcgcgcgacgatggagcacgtgatgacggtgctttcggcggcc
atcaccaaccagtacacctgcctcgacggcttcgcgtaccagagcggcgggcgcgtgcgg
cgctacatcgagccgaccttccaccacgtgtcccgcatggtgagcaactcgctggccatg
gccaagaagctgcccggcgccggcgcctcagcggcgccagcgccgccgcggcagccgttc
acggggtacgggcagatggtgaaggggttcccccggtgggtgcgtcccggggaccggcgc
ctgctgcaggccccggcgtcggccgttgccgccgacgcggtggtggccaaggacggcagc
ggggactacacgacggtggcggcggccgtggcagccgcccccaccaactcgaagaagcgg
cacgtgatctacattaaggccggcgcgtacatggagaacgtggaggtcgggaagaagcac
gtcaacctcatgttcgtcggcgacggcatcggcaagaccgtcatcaaggccagccgcaac
gtcgtcgacggctacaccaccttccgctcggccacagtcgctgtggtgggcaacaacttc
ttggcccgcgacctgacgatcgagaactcggccgggccgtcgaagcaccaggcggtggcg
ctccgcgtgggggcggacctgtcggcgttctaccggtgcagcttcgtggggtaccaggac
actctgtacgtgcactcgctgcggcagttcttccgcgactgcgacgtctacggcaccatc
gacttcgtgttcggcaacgcggccgtggtgctgcagggctgcaacctgtacgcgcgcaag
ccgctgccgaaccagagcaacatcttcacggcgcaggggcgggaggaccccaaccagaac
acgggcatctccatccagaggtgcaaggtggcggcggcggccgacctcgccgccgcccag
tcctccaccaagacctacctgggccgcccatggaagcagtactcccgcacggtgtacctg
cagtcggagctggactcgctggtcgacccggccggctggctcgagtggaacggcagcttc
gcgctcgacacgctctactacggcgagtacatgaacacggggcccggcgccggcacgtcc
gggcgggtcaagtggaaggggtaccgcgtcatcaccagcgccgccgaggccagcgccttc
accgttggcaacttcatcgacggcgacctctggctcgccggcacgtccatccccttcacc
accggcttgtga

DBGET integrated database retrieval system