KEGG   Zea mays (maize): 100280339Help
Entry
100280339         CDS       T01088                                 

Definition
putative ubiquitin carboxyl-terminal hydrolase superfamily protein
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
zma  Zea mays (maize)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 368 aa AA seqDB search
MVMGASGSKLEKALGDQFPEGERYFGLENFGNTCYCNSVLQALYFCIPFREQLLEYYANN
KTPGDAEENLLTCLADLFMQISQAKKKTGVIAPKRFVQRVKKQNELFRSYMHQDAHEFLN
FLLNELVDILEKESSAAKDSPQSSSPEKAPNGPVQPLANGVKKEPPVTLVHKSFQGILTN
ETRCLRCETVTARDETFLDLSVDIEQNSSITSCLKNFCSTETLNAEDKFFCDKCCSLQEA
QKRMKIKKAPHILVIHLKRFKYIEQLGRYKKLSYRVVFPMELKLSNSSDDVDTEYSLFAV
VVHVGSGPNHGHYVSLVKSHNHWLFFDDENVEMVEEQTLQTFFGTSHEYSGNTDHGYILF
YEGLGGKS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggtcatgggagccagcggctccaagcttgagaaggccctcggagaccagttcccggaa
ggcgagcgctacttcggcctcgagaacttcggcaacacctgctactgcaacagtgtcctt
caggcactttatttttgcattccattcagggagcagttactggaatattatgcaaataac
aaaactccaggagacgctgaggaaaatcttctgacttgtttggccgacctttttatgcag
ataagccaagcaaagaaaaagaccggtgttattgctccaaaacgttttgttcagagagtg
aagaaacagaatgagttgtttcgcagctacatgcaccaggatgcacatgagttcttaaat
ttccttttgaatgaacttgttgatattctggaaaaagagtcaagtgctgctaaggactca
ccccaatcgtcgtctcctgaaaaagctccaaatggcccagttcaacctttagccaatgga
gttaaaaaagaaccaccagttaccctggtccataaaagttttcagggcatattgaccaac
gaaacaagatgcttaagatgtgaaacagtaactgcaagggatgaaacatttcttgatctt
agtgttgacattgaacaaaatagttcaatcacaagctgcctgaaaaatttctgttctaca
gagactttaaatgcagaggataaattcttctgtgacaaatgctgcagtttgcaagaagca
cagaagagaatgaagattaagaaggctccccacatattggtgatccatctaaagcgtttc
aagtacattgagcagcttggccggtataagaagctttcatacagggttgtattccccatg
gaactgaagctcagtaattcatccgacgatgtagacactgagtactccctctttgctgtc
gtggtccatgtcggaagtggcccgaaccatgggcattatgtaagccttgtcaaaagccac
aaccactggttgttcttcgacgatgaaaatgtcgagatggttgaagagcagaccctacaa
acattcttcggtacttcacatgaatactcaggcaacacggaccatgggtatatcttgttt
tacgaggggcttggtgggaagagttag

DBGET integrated database retrieval system