KEGG   Zea mays (maize): 100280624Help
Entry
100280624         CDS       T01088                                 

Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
zma  Zea mays (maize)
Pathway
zma00020  Citrate cycle (TCA cycle)
zma00310  Lysine degradation
zma01100  Metabolic pathways
zma01110  Biosynthesis of secondary metabolites
zma01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100280624
  Amino acid metabolism
   00310 Lysine degradation
    100280624
Enzymes [BR:zma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     100280624
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl HlyD_D23 HlyD_3 PYNP_C GCV_H
Motif
Other DBs
NCBI-GeneID: 100280624
NCBI-ProteinID: NP_001147014
UniProt: B6SJN5
Position
10
AA seq 446 aa AA seqDB search
MASRVASGLLRRRAGATLGLLRSYAHVRSYNSQLSALVSATSECSNLPRRCYYLPNPSPY
QVWSRSFASDNGDKFEAVVPFMGESVTDETLANFLKKPGDRVEADEPIAQIETDKVTIDV
ASPEAGVIEKLIASEGDTVTPGTKVAIISKSAQPAETHVAPSEEATSKESSPPKVEDKPK
VEEKAPKVDPPKMQAPKPTAPSKTSPSEPQLPPKERERRVPMPRLRKRIANRLKDSQNTF
AMLSTFNEVDMTNLMKLRSDYKDEFVTKHGVKLGLMSCFVKAAVSALQNQPIVNAVIDGD
DIIYRDYVDISVAVGTSKGLVVPVIRDADTMNFADIEKGINNLAKKATEGALSIDDMAGG
TFTISNGGVYGSLLSTPIINPPQSSILGMHSIVQRPVVVNGDILARPMMYLALTYDHRLI
DGREAVFFLRRIKDVVEDPRRLLLDI
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcccgcgtcgcctcgggcctcctccgccgccgcgccggcgccacactaggcctc
ctaaggagttatgcacatgtcagaagctacaacagtcaactttcagctttggtttctgct
acatctgaatgctcaaatctgccgagaagatgctattacttacctaatccctctccatac
caagtttggagtaggtcatttgcttcagacaacggagacaagtttgaggctgttgtgccc
ttcatgggtgaatctgtaactgatgaaactcttgctaacttcttaaagaaacctggagac
agagtcgaggctgatgaacctatagcgcagattgaaactgataaggtcactatagatgtc
gcaagtcctgaggctggtgttattgaaaagctcattgctagtgaaggcgacacagttact
ccaggcactaaagttgcaatcatatccaagtctgctcaacctgctgaaacacatgttgct
ccatcagaggaagcaacttcaaaagaatcatctccaccaaaagttgaagataaaccaaag
gtagaggaaaaagccccaaaagtagatcctcccaagatgcaagcaccaaagccaactgca
ccatcaaaaacatccccttcagaaccacagctccctccaaaagaacgagagcggcgggtg
ccaatgccaaggctcaggaagcgtattgcaaaccgtcttaaggattctcagaacaccttt
gcaatgctgagtacatttaatgaagttgacatgaccaatttgatgaagcttcgttctgat
tataaagatgaatttgtcacaaagcatggtgtaaaattgggtcttatgtcttgctttgtc
aaggctgctgtttctgcacttcaaaaccagccaattgtcaatgctgtcattgatggtgat
gacatcatatacagagactacgtagacatcagtgttgctgttggcacttccaagggcctt
gtggttcctgttatccgagatgctgataccatgaactttgctgacattgagaaagggata
aacaaccttgcaaagaaagcaactgagggggcgctctcaattgatgacatggcaggagga
acattcaccatctccaacggtggtgtctatggaagcctcctcagcacacctatcatcaac
cctccacagtcgtctattctggggatgcattccattgtgcaacgccctgtggttgtgaat
ggtgacatccttgcgaggccaatgatgtaccttgcgctgacttacgaccacaggttgatc
gatggcagagaggctgtcttcttcctgcggcgcatcaaggatgttgtcgaggaccccagg
aggttgctgcttgacatataa

DBGET integrated database retrieval system