KEGG   Zea mays (maize): 100280694Help
Entry
100280694         CDS       T01088                                 

Definition
pyrophosphate--fructose 6-phosphate 1-phosphotransferase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
zma  Zea mays (maize)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100280694
   01230 Biosynthesis of amino acids
    100280694
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100280694
   00030 Pentose phosphate pathway
    100280694
   00051 Fructose and mannose metabolism
    100280694
   00052 Galactose metabolism
    100280694
Enzymes [BR:zma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100280694
Protein phosphatases and associated proteins [BR:zma01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100280694
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 525 aa AA seqDB search
MAVAPMDCGAGSISLGHKVLCRFGVPNSSRLRWVGYDRKQRTDQLIARAVSVDRTQLDFS
NPDWKTQFQEDFDKRFSLPHLTDVIDVEPRPTTFSLKSRAPLENANGTMQGSWNGYVNDY
DRALLKVIKFASPTSAGADCIDPDCSWVEQWVHRAGPRKQIYFEPQYVKAGIVSCGGLCP
GLNDVIRQIVLTLEKYGVKNIVGIQHGFRGFFEDHLSEVPLSRHVVQNINLAGGSFLGVS
RGGANISDIVDSIQARRLDMLFVLGGNGTHAGANAIHDECRKRKLQVSIVCVPKTIDNDI
LLMDKTFGFDTAVEAAQRAINSAYIEAHSAFHGIGLVKLMGRSSGFITMHASLSSGQVDI
CLIPEVPFTVDGPNGVLRHLEHLIETKGFALVCVAEGAGQEYFQKSNATDASGNMVLSDI
GVHLQQKIKSHFKDIGVHSDVKYIDPTYMLRAVRANASDAILCTVLGQNAVHGAFAGFSG
ITTGVCNTHNVYLPIPEVIKSTRFIDPNSRMWHRCLTSTGQPDFH
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggcagtagcgcccatggactgcggtgctggttcgattagtctaggccacaaggtttta
tgccgtttcggagtacccaacagcagtagattgcgatgggtgggatatgacaggaaacaa
aggacagatcagttgattgctagagccgtatccgtggatcggacacaactagacttctcg
aatccggactggaagacgcagtttcaagaggatttcgataagcgcttcagcttgccacac
ttgacagatgtaattgatgtggaaccgaggccaactactttttctctcaagagcagagcc
cctcttgagaacgcgaatggtaccatgcaaggatcatggaacggctatgtcaatgattat
gacagagcacttttgaaggttattaagtttgcctcaccaacttctgctggagctgactgc
attgaccctgattgtagctgggttgaacaatgggtgcaccgtgctggtccacgcaaacaa
atatattttgagcctcaatatgtgaaggctgggattgtgtcgtgtggtgggctctgccca
ggtctcaatgatgtcattcggcagattgtgcttacacttgaaaaatatggggtgaaaaac
attgttgggatacagcatggattccgtggattttttgaggatcacttatcagaagtgcca
ctttctaggcatgtagtccaaaatatcaatcttgctggtggtagcttcttaggagtctct
cgcggtggtgcaaacatttcagacattgttgacagtattcaggctaggaggcttgatatg
ctatttgtgcttggtggaaatggaacacatgctggagctaatgctatacatgatgagtgc
cgcaagagaaaactgcaagtatcgattgtatgtgtccccaaaactattgacaatgacata
ttactgatggacaagacctttggatttgatactgcagtggaagctgcacaaagagctatc
aactctgcatacattgaggcacattctgcatttcatggcattggactggtcaagctgatg
ggaagaagcagcggcttcatcacaatgcatgcctccctgtcaagtggccaagtagatatc
tgtctgatacctgaggtaccattcactgttgatggaccgaatggagttcttcgacatctc
gaacacctgatagagaccaagggatttgctctggtttgcgttgctgaaggagcaggacag
gaatactttcaaaagtcaaatgcaactgatgcatcagggaacatggttcttagtgacatt
ggtgtgcaccttcagcagaagatcaagtcccattttaaggacataggagtccattctgat
gtcaagtatattgatccaacatacatgctccgcgctgtgcgagccaatgcatccgatgcc
atcctgtgcaccgtgcttggtcagaatgctgttcatggtgcctttgcgggttttagcggc
atcacaaccggggtgtgcaacacacacaatgtgtacttgccgataccggaagtgatcaaa
tccacgaggtttattgatccaaacagtcggatgtggcaccggtgcctgacctcaaccggg
caaccagacttccattga

DBGET integrated database retrieval system