KEGG   Zea mays (maize): 100280694Help
Entry
100280694         CDS       T01088                                 

Definition
(RefSeq) pyrophosphate--fructose 6-phosphate 1-phosphotransferase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
zma  Zea mays (maize)
Pathway
zma00010  Glycolysis / Gluconeogenesis
zma00030  Pentose phosphate pathway
zma00051  Fructose and mannose metabolism
zma00052  Galactose metabolism
zma01100  Metabolic pathways
zma01110  Biosynthesis of secondary metabolites
zma01200  Carbon metabolism
zma01230  Biosynthesis of amino acids
zma03018  RNA degradation
Module
zma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100280694
   00030 Pentose phosphate pathway
    100280694
   00051 Fructose and mannose metabolism
    100280694
   00052 Galactose metabolism
    100280694
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    100280694
Enzymes [BR:zma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100280694
Protein phosphatases and associated proteins [BR:zma01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100280694
Messenger RNA biogenesis [BR:zma03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100280694
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 100280694
NCBI-ProteinID: NP_001147085
UniProt: C4J1M8 B6SKL0
Position
1
AA seq 525 aa AA seqDB search
MAVAPMDCGAGSISLGHKVLCRFGVPNSSRLRWVGYDRKQRTDQLIARAVSVDRTQLDFS
NPDWKTQFQEDFDKRFSLPHLTDVIDVEPRPTTFSLKSRAPLENANGTMQGSWNGYVNDD
DRALLKVIKFASPTSAGADCIDPDCSWVEQWVHRAGPRKQIYFEPQYVKAGIVSCGGLCP
GLNDVIRQIVLTLEKYGVKNIVGIQHGFRGFFEDHLSEVPLSRHVVQNINLAGGSFLGVS
RGGANISDIVDSIQARRLDMLFVLGGNGTHAGANAIHDECRKRKLQVSIVCVPKTIDNDI
LLMDKTFGFDTAVEAAQRAINSAYIEAHSAFHGIGLVKLMGRSSGFITMHASLSSGQVDI
CLIPEVPFTVDGPNGVLRHLEHLIETKGFALVCVAEGAGQEYFQKSNATDASGNMVLSDI
GVHLQQKIKSHFKDIGVHSDVKYIDPTYMLRAVRANASDAILCTVLGQNAVHGAFAGFSG
ITTGVCNTHNVYLPIPEVIKSTRFIDPNSRMWHRCLTSTGQPDFH
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggcagtagcgcccatggactgcggtgctggttcgattagtctaggccacaaggtttta
tgccgtttcggagtacccaacagcagtagattgcgatgggtgggatatgacaggaaacaa
aggacagatcagttgattgctagagccgtatccgtggatcggacacaactagacttctcg
aatccggactggaagacgcagtttcaagaggatttcgataagcgcttcagcttgccacac
ttgacagatgtaattgatgtggaaccgaggccaactactttttctctcaagagcagagcc
cctcttgagaacgcgaatggtaccatgcaaggatcatggaacggctatgtcaatgatgat
gacagagcacttttgaaggttattaagtttgcctcaccaacttctgctggagctgactgc
attgaccctgattgtagctgggttgaacaatgggtgcaccgtgctggtccacgcaaacaa
atatattttgagcctcaatatgtgaaggctgggattgtgtcgtgtggtgggctctgccca
ggtctcaatgatgtcattcggcagattgtgcttacacttgaaaaatatggggtgaaaaac
attgttgggatacagcatggattccgtggattttttgaggatcacttatcagaagtgcca
ctttctaggcatgtagtccaaaatatcaatcttgctggtggtagcttcttaggagtctct
cgcggtggtgcaaacatttcagacattgttgacagtattcaggctaggaggcttgatatg
ctatttgtgcttggtggaaatggaacacatgctggagctaatgctatacatgatgagtgc
cgcaagagaaaactgcaagtatcgattgtatgtgtccccaaaactattgacaatgacata
ttactgatggacaagacctttggatttgatactgcagtggaagctgcacaaagagctatc
aactctgcatacattgaggcacattctgcatttcatggcattggactggtcaagctgatg
ggaagaagcagcggcttcatcacaatgcatgcctccctgtcaagtggccaagtagatatc
tgtctgatacctgaggtaccattcactgttgatggaccgaatggagttcttcgacatctc
gaacacctgatagagaccaagggatttgctctggtttgcgttgctgaaggagcaggacag
gaatactttcaaaagtcaaatgcaactgatgcatcagggaacatggttcttagtgacatt
ggtgtgcaccttcagcagaagatcaagtcccattttaaggacataggagtccattctgat
gtcaagtatattgatccaacatacatgctccgcgctgtgcgagccaatgcatccgatgcc
atcctgtgcaccgtgcttggtcagaatgctgttcatggtgcctttgcgggttttagcggc
atcacaaccggggtgtgcaacacacacaatgtgtacttgccgataccggaagtgatcaaa
tccacgaggtttattgatccaaacagtcggatgtggcaccggtgcctgacctcaaccggg
caaccagacttccattga

DBGET integrated database retrieval system