KEGG   Zea mays (maize): 100280704Help
Entry
100280704         CDS       T01088                                 

Definition
beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
zma  Zea mays (maize)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100280704
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100280704
   00603 Glycosphingolipid biosynthesis - globo series
    100280704
   00604 Glycosphingolipid biosynthesis - ganglio series
    100280704
   00511 Other glycan degradation
    100280704
Enzymes [BR:zma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     100280704
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 578 aa AA seqDB search
MATVLLPLLLLLGSAVTLLTCAGAGASFPVNVWPKPTSMSWAEPHAAVPVSPSFHIVASS
GNPYLASAAERYAKLLFRETYRPIVRPAVNVTAGNALEKLTVAVSDLAAPLQHGVDESYT
LEILPTGAATVTAATAWGAMRGLETFSQLSWRAGRGDLLLVAAGVRVEDRPLYPHRGLML
DTGRTYFPVADILRTIDAMAANKMNVFHWHITDSQSFPIVLPSEPSLAEKGAYGEDMRYT
VEDVEHIVEFAMSRAVRVVPEIDSPGHTASWAGAYPEAVTCAGKFWLPDGDWNHGLAAEP
GSGQLNPLAAKTYEVITNVVNDLTSLFPDGFYHAGADEVTPGCWEADPTIQADLERGATL
SQLLERYVSAVHPLVVSRNRTAVYWEDVLLDAAVNVSASAIPPATTVLQSWNNGPNNTKL
IVQAGYRAIVSSASFYYLDCGHGDFVGNNSIYDDPNSDFDANGGSWCGPYKTWQRVYDYD
IAYGLTPEEAQLVLGGEVAMWTEQVDTTVLDGRVWPRASAMAEALWSGNRDASGRKRYAE
ATDRLIDWRQRMVGRGVRAEPIQPLWCRTRPGMCNAVQ
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggtcctccttccgctgctgctcttgctcggctcggcggtgacgctcctaacg
tgcgcgggcgcgggcgcgtcgttccccgtcaatgtctggccaaagccgacgtccatgtca
tgggcggagccgcacgcggccgtaccggtgtcgccgtccttccacatcgtggcgtcatcg
ggtaacccgtacctcgcctcggccgcggagcgctacgccaagctgctgttcagggagacg
taccgacccatcgttcggccggcggtcaacgtcaccgcggggaacgcgctggagaagctg
accgtggcggtgtccgacctcgccgccccgctgcagcacggcgtggacgagtcctacacg
ctggagatcctccccacgggcgccgccacggtgaccgcggccaccgcgtggggcgccatg
cgcgggctggagacgttctcgcagctgtcgtggcgggccggccgcggggacctcctgctg
gtggccgccggcgtgcgcgtcgaggaccggcccctgtacccgcaccgcgggctgatgctc
gacaccggcaggacctacttccccgtggccgacatcctgcggaccatcgacgccatggcg
gccaacaagatgaacgtgttccactggcacatcacggactcgcagtcgttccccatcgtg
ctgccctccgagccgtcgctcgccgagaagggcgcctacggagaggacatgcggtacacc
gtcgaggatgtcgagcacatcgtcgagttcgccatgagccgcgccgtccgcgtcgtgccg
gagatcgactcgcctggccacacagcttcgtgggccggcgcgtacccggaggccgttacc
tgcgcgggcaagttctggctgcccgacggcgactggaaccacggcctygccgccgagccg
ggctccggccagctgaacccgctggcggccaagacgtacgaggtcatcaccaacgtggtc
aacgacctgacctccctcttcccggacggcttctaccacgccggcgccgacgaggtcacc
ccgggttgctgggaggcggaccccacgatccaggccgacctggagcgcggcgccacgctg
agccagctcctggagcggtacgtgagcgcggtgcacccgctggtggtgtccaggaaccgc
acggccgtgtactgggaggacgtgctgctggacgcggccgtgaacgtgagcgcgtcggcg
atcccgccggccaccaccgtcctgcagtcgtggaacaacgggcccaacaacaccaagctg
atcgtgcaggccgggtaccgcgccatcgtctcctccgcctccttctactacctggactgc
gggcacggcgacttcgtcggcaacaacagcatctacgacgaccccaacagcgacttcgac
gcgaacggcgggtcctggtgcgggccctacaagacgtggcagcgggtgtacgactacgac
atcgcgtacgggctcacccccgaggaggcccagctggtcctcggcggcgaggtggcgatg
tggacggagcaggtcgacacgaccgtcctggacggccgggtgtggccgagagcctcggcc
atggcggaggcgctctggtctggcaaccgcgacgcgtcgggcaggaagcggtacgccgag
gcgaccgaccggctcatcgactggcggcagcgcatggtcgggaggggggtccgggccgag
cccatccagccgctttggtgccgaacacgacccggaatgtgcaacgcggtccagtga

DBGET integrated database retrieval system