KEGG   Zea mays (maize): 100280823Help
Entry
100280823         CDS       T01088                                 

Definition
triosephosphate isomerase, cytosolic (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
zma  Zea mays (maize)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100280823
   01230 Biosynthesis of amino acids
    100280823
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100280823
   00051 Fructose and mannose metabolism
    100280823
   00562 Inositol phosphate metabolism
    100280823
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    100280823
Enzymes [BR:zma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     100280823
Exosome [BR:zma04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100280823
  Exosomal proteins of bladder cancer cells
   100280823
  Exosomal proteins of melanoma cells
   100280823
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 256 aa AA seqDB search
MASRKFFVGGNWKCNGTGEDVKKIVTVLNQAEVPSEDVVEVVVSPPFVFLQQVKGLLRLD
FAVAAQNCWVRKGGAFTGEISAEMLVNLQVPWVILGHSERRALLGESSDFVADKVAYALT
QGLKVIACIGETLEQREAGTTMDVVAAQTKAIAEKISDWTNIVLAYEPVWAIGTGKVATP
AQAQEVHDGLRKWLHSNVSPAVAELTRIIYGGSVNGANCKELAAQPDVDGFLVGGASLKP
EFVDIIKSATVKSSSA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaggaagttcttcgtgggtggcaactggaaatgcaacggtactggcgaggac
gtgaagaagatcgtcaccgtgctcaaccaagccgaggtgccctctgaagacgtcgtcgag
gtggtggtgagtccgcctttcgtttttctgcagcaggtcaaggggctgctgcggctggac
ttcgccgtcgcagcgcagaactgctgggtgcgcaagggcggcgccttcaccggcgagatc
agtgctgagatgctggtaaacctgcaggtgccctgggtcattttgggacattctgagcgc
agagctctgttgggtgaatccagtgattttgttgctgataaagttgcatatgcactcact
caaggtctcaaggtaattgcttgcattggtgagacccttgagcagagagaggcaggaaca
acaatggatgttgttgctgcacaaacaaaggctattgctgaaaaaatatcagattggaca
aatattgtgttggcatatgaaccagtttgggctattggtaccggcaaagttgcaactcct
gctcaggctcaggaggttcatgatggtctgagaaagtggctccactccaatgttagccct
gcagttgctgaattgacaaggataatttatggagggtctgtaaatggagctaactgcaaa
gaacttgcagctcaaccagatgttgatggattccttgttggtggagcctcattgaagcct
gaattcgtggacatcatcaagtctgccactgtcaagtcttcatctgcctag

DBGET integrated database retrieval system