KEGG   Zea mays (maize): 100280970Help
Entry
100280970         CDS       T01088                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
zma  Zea mays (maize)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100280970
  Lipid metabolism
   00561 Glycerolipid metabolism
    100280970
   00600 Sphingolipid metabolism
    100280970
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    100280970
Enzymes [BR:zma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     100280970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 412 aa AA seqDB search
MAGGRGSSAARLALLLLVVVTAAGAVAGGKVVHVEEAHRRSMLANGLGSAPPMGWNSWNH
FQCDGNGEVVIRETADALVSTGLAALGYRYVNIDDCWAGPQRDAKGNLVANTKTFPHGIK
ALADYVHGKGLKLGIYSDAGFQTCAKAQPGSLGHEELDAKTFAAWGVDYLKYDNCNNGDL
KPLERYPEMSRALMKVGRPIYFSLCEWGDMHPATWGATYGNSWRTTNDIADTWDSMIATA
DQNEVWSEYARPGGWNDPDMLEVGNGGMTNSEYVVHFSLWAISKAPLIIGCDVRHMSRET
YAILANKEVIAVNQDPLGVQGKKVRMEGSSEIWAAPLSEYRTAVLLLNRHAKDEATITAH
WDDIGLPAGTPVEARDLWLHETLDATFTDKMSFDVAPHSCRMLVLKPRIQIQ
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtggacgtggctcgtcggcggcgaggctagcgctgctgctgctggtggtggtg
acggcggccggcgccgtggcggggggcaaggtggtgcacgtggaggaggcgcaccggcgg
agcatgctggccaatggactcggctcggcccctcccatggggtggaacagctggaaccat
ttccagtgcgacggcaacggcgaggtggtcatcagggagaccgcggacgcgctcgtgtcg
accggactcgccgctctcggctacagatacgtcaacatcgatgattgctgggcagggcca
caacgtgacgctaagggcaacctggtggccaacaccaagacgttcccgcacgggatcaag
gcgctggcggactacgtccacggcaaggggctcaagctcgggatctactccgacgccgga
ttccagacctgcgccaaggcccagcccgggtccctcgggcacgaggagctggacgccaag
accttcgcggcatggggggtggattacctcaagtacgacaactgcaacaacggcgacctg
aagccgctggagaggtacccggagatgagcagagcactgatgaaggtggggcggccgatc
tacttctcgctctgcgaatggggcgacatgcacccggcgacgtggggcgcgacctacggc
aacagctggaggaccaccaacgacatcgccgacacctgggacagcatgatcgccacggcg
gaccagaacgaggtgtggtcggagtacgcgcgtcccggcggatggaacgatccggacatg
ctggaggtgggcaacgggggcatgaccaacagcgagtacgtcgtgcacttcagcctctgg
gcgatctccaaggcgcctctcatcatcggctgcgacgtcaggcatatgtcgcgggagacg
tacgccatcctggccaacaaggaggtgatcgccgtcaaccaagatccgctcggcgtgcag
gggaagaaggtgcggatggagggcagcagcgagatctgggccgcgccgctctccgagtac
cggacggcggtgctgctcctgaaccggcacgccaaggacgaggccaccatcaccgcgcac
tgggacgacatcggcctccccgccggcacgcccgtcgaggccagggacctgtggctgcac
gagacgttggacgccacgttcacggacaagatgagcttygacgtcgcgccgcactcgtgc
aggatgctcgtcctcaagcccaggatccagatccagtga

DBGET integrated database retrieval system