KEGG   Zea mays (maize): 100280970Help
Entry
100280970         CDS       T01088                                 

Gene name
GRMZM2G095126, IDP408
Definition
(RefSeq) alpha-galactosidase
  KO
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
zma  Zea mays (maize)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo and isoglobo series
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100280970 (GRMZM2G095126)
  Lipid metabolism
   00561 Glycerolipid metabolism
    100280970 (GRMZM2G095126)
   00600 Sphingolipid metabolism
    100280970 (GRMZM2G095126)
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    100280970 (GRMZM2G095126)
Enzymes [BR:zma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     100280970 (GRMZM2G095126)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 414 aa AA seqDB search
MAGGRGSSAARLALLLVVVVAAVAGGAVAGGKVVHVEEAHRRSMLANGLGSAPPMGWNSW
NHFQCDGNGEVVIRETADALVSTGLAALGYRYVNIDDCWAEPQRDAKGNLVANTKTFPHG
IKALADYVHGKGLKLGIYSDAGFQTCAKAQPGSLGHEELDAKTFAAWGVDYLKYDNCNNG
DLKPLERYPEMSRALMKVGRPIYFSLCEWGDMHPATWGATYGNSWRTTNDIADTWDSMIA
TADQNEVWSEYARPGGWNDPDMLEVGNGGMTNSEYVVHFSLWAISKAPLIIGCDVRHMSR
ETYAILANKEVIAVNQDPLGVQGKKVRMEGSSEIWAAPLSEYRTAVLLLNRHAKDEATIA
AHWDDIGLPAGTPVEARDLWLHETLDATFTDKMSFDVAPHSCRMLVLKPRIQIQ
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtggtcgtggctcgtcggcggcgaggctagcgctgctactggtggtggtggtg
gcggcggtggcgggcggcgccgtggcggggggcaaggtggtgcacgtggaggaggcgcac
cggcggagcatgctggccaatggcctcggctcggcccctcccatggggtggaacagctgg
aaccatttccagtgcgacggcaacggcgaggtggtcatcagggagaccgcggacgcgctc
gtgtcgaccggactcgccgctctcggctacagatacgtcaacatcgatgattgctgggca
gagccacaacgtgacgctaagggcaacctggtggccaacaccaagacgttcccgcacggg
atcaaggcgctggcggactacgtccacggcaaggggctcaagctcgggatctactccgac
gccgggttccagacctgcgccaaggcccagcccgggtccctcggacacgaggagctggac
gccaagaccttcgcggcatggggggtggattacctcaagtacgacaactgcaacaacggc
gacctgaagccgctggagaggtacccggagatgagcagagcactgatgaaggtggggcgg
ccgatctacttctcgctctgcgaatggggcgacatgcacccggcgacgtggggcgcgacc
tacggcaacagctggaggaccaccaacgacatcgccgacacctgggacagcatgatcgcc
acggcggaccagaacgaggtgtggtcggagtacgcgcgccccggcggatggaacgatccg
gacatgctggaggtgggcaacgggggcatgaccaacagcgagtacgtcgtgcacttcagc
ctctgggcgatctccaaggcgcctctcatcatcggctgcgacgtcaggcacatgtcgcgg
gagacgtacgccatcctggccaacaaggaggtgatcgccgtcaaccaagatccgctcggc
gtgcaggggaagaaggtgcggatggaggggagcagcgagatctgggccgcgccgctctcc
gagtaccggacggcggtgctgctcctgaaccggcacgccaaggacgaggccaccatcgcc
gcgcactgggacgacatcggcctccccgccggcacgcccgtcgaggccagggacctgtgg
ctgcacgagacgttggacgccacgttcacggacaagatgagcttcgacgtcgcgccgcac
tcgtgcaggatgctcgtcctcaagcccaggatccagatccagtga

DBGET integrated database retrieval system