KEGG   Zea mays (maize): 100281192Help
Entry
100281192         CDS       T01088                                 

Gene name
TIDP3459
Definition
LOC100281192
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
zma  Zea mays (maize)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100281192 (TIDP3459)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100281192 (TIDP3459)
   00603 Glycosphingolipid biosynthesis - globo series
    100281192 (TIDP3459)
   00604 Glycosphingolipid biosynthesis - ganglio series
    100281192 (TIDP3459)
   00511 Other glycan degradation
    100281192 (TIDP3459)
Enzymes [BR:zma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     100281192 (TIDP3459)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 545 aa AA seqDB search
MPPNRPAYLLSALLLAAAAAAVGARRHASPAANATFAGEPVYLWPLPKSVSSGSRTLTVD
PDLALDPQGLGGRSPAVAEAFQRYRGLVFAPWAHAARAGRARYDVTRLTVVVASANDTLA
LGVDESYAIYVAAAGGVDSIVGGAIIEANTIYGAIRGLETFSQLCVFNYDTKNVEVHNAP
WHIQDEPRFAFRGLLLDTSRHYLPVDVIKQVIDSMSFAKLNVLHWHIIDEQSFPLEVPTY
PNLWKGSYSKWERYTVEDAHDIVNYAKKRGINVMAEIDVPGHAESWGNGYPKLWPSPICT
EPLDVSSDFTFEVIFGILSDMRKIFPFGLFHLGGDEVYTGCWNTTPHVRQWMDERKMTTK
DAYKYFVLKAQELAIKLNWTPVNWEETFNSFEENLNPLTVVHNWLGPGVCPKVVAKGFRC
IMSNQGVWYLDHLDVPWEDVYSGEPLAGISDREQQKLVLGGEVCMWGETADTSDVLQTIW
PRAAAAAERLWSQLEAISAQDVETTVLSRLHRFRCLLNHRGVAAAPVTNYYARRPPVGPG
SCFVQ
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgccccccaaccgccccgcttacctgctctccgccctcctcctcgccgccgccgccgcg
gccgtcggcgcgcgtcgccacgcgtcgccggccgcgaacgctaccttcgccggagagccc
gtctacctctggccgctgcccaagagcgtctcgtccggatcccggacgctgacggtggac
ccggacctcgcgctcgacccgcagggcctcggcggccgctccccggccgtggccgaggcg
ttccagcggtaccggggcctcgtgttcgcgccgtgggcgcacgccgcgcgcgcgggccgc
gcgcggtacgacgtcaccaggctcaccgtcgtcgttgcctccgccaacgacacgctggcg
ctgggggtggacgagagctacgccatctacgtggcggcggccgggggcgtcgattccatc
gtcggaggagcaatcattgaggcaaacacaatatatggagctattcgaggactggagaca
ttcagtcaactttgtgttttcaactatgacaccaaaaatgttgaagtgcacaatgctcca
tggcatatccaagatgagccccgctttgcttttcgtgggctgctcctagacacctcaagg
cattatcttccagttgatgttattaagcaagtgatcgactctatgtcatttgctaagctg
aacgttcttcattggcatatcatcgatgagcaatcctttccattggaggtgccaacatat
ccaaacctttggaaaggttcatactccaaatgggagcgctacaccgtggaagatgcacat
gatattgtcaactacgctaagaaaagaggtatcaatgtgatggcagaaattgacgtgcct
ggtcatgcagaatcatggggaaatggatacccaaagctctggccttctcccatttgtaca
gagccattagatgtctctagtgatttcacatttgaagtaatttttggaattttgtctgat
atgaggaaaatctttccattcgggctgtttcacttgggtggtgatgaagtatacacaggg
tgctggaacacaacgcctcacgtgcggcagtggatggacgagcgcaaaatgaccacgaag
gacgcttacaaatacttcgttctgaaggcccaggagctggcgatcaagctgaactggact
cccgtgaactgggaagaaaccttcaactcgttcgaagaaaacctcaatccactgacggtt
gtgcacaactggctggggcccggagtctgcccaaaggttgtggccaagggtttcagatgc
ataatgagcaaccaaggcgtctggtacctggaccacctcgacgtcccctgggaggacgtc
tacagcggcgagccgctcgccgggatcagcgacagagagcagcagaagctggtgctcggc
ggggaggtctgcatgtggggcgagacggccgacacgtccgacgtcctgcagacaatctgg
ccccgagccgccgcagcggcagagcgtctgtggagccagctggaggccatatccgcccag
gacgtcgagacgaccgtgctgtcacggctacaccgcttcaggtgcctgctgaaccaccgt
ggggtcgccgcggctcctgtcacgaactactacgctcggaggccgccggtcggcccgggt
tcgtgcttcgttcagtaa

DBGET integrated database retrieval system