KEGG   Zea mays (maize): 100281464Help
Entry
100281464         CDS       T01088                                 

Gene name
GRMZM5G879882
Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
zma  Zea mays (maize)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100281464 (GRMZM5G879882)
   01230 Biosynthesis of amino acids
    100281464 (GRMZM5G879882)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100281464 (GRMZM5G879882)
   00030 Pentose phosphate pathway
    100281464 (GRMZM5G879882)
   00051 Fructose and mannose metabolism
    100281464 (GRMZM5G879882)
   00052 Galactose metabolism
    100281464 (GRMZM5G879882)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    100281464 (GRMZM5G879882)
Enzymes [BR:zma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100281464 (GRMZM5G879882)
Protein phosphatases and associated proteins [BR:zma01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100281464 (GRMZM5G879882)
Messenger RNA biogenesis [BR:zma03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100281464 (GRMZM5G879882)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 564 aa AA seqDB search
MASSHIILPKEEEEEAAAAAVAEVGLGAAVEADHDHRPYQEQGPGKAALPFSATCVRISR
DSYPNLRALRNASTMTLHDDDAAFVKLEEGDYGYVLDDVPHLTDYLPDLPTFPNPLQDHP
AYSTVKQYFVNADDTVPEKVVVQKNSPRGVHFRRAGPRQRVYFESEEAKACIVTCGGLCP
GLNTVIRELVCGLSHMYNVSNVFGIQNGYKGFYSSNYLPMTPKSVNDIHKRGGTVLGTSR
GGHDTKKIVDNIQDRGINQVFIIGGDGTQKGAYEIYKEIRRRGLQVAVAGIPKTIDNDIA
VIDKSFGFDTAVEEAQRAINAAHVEASSAENGIGLVKLMGRYSGFIAMYATLASRDVDCC
LIPESPFYLEGEGGLFEYIDRRLKENNHTVIVVAEGAGQDLIAQSIPAADQQDASGNKLL
LDVGLWLTHKIKDYCKSKKMEMTIKYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAG
YSFTVGMVNGRHAYIPFHRVTSTRNKVRITDRMWARLLSSTNQPSFLSQKDIDAAREADK
AANRMKSREDAKKQSTPVLANGEK
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtcccacatcatcctgcccaaggaggaggaggaggaggcggctgcggcagcg
gtggcggaggtcgggttgggagcggcggtggaggcggaccacgaccaccggccgtaccag
gagcaggggcccgggaaggcggcgctgccgttctcggcaacgtgcgtccggatctcccgc
gactcgtacccgaacctccgcgcgctgcggaacgcgtcgaccatgacactccacgatgat
gacgccgccttcgtcaagctcgaggagggcgactacggatacgtgctcgacgacgtcccg
cacctcaccgactacctcccggacctccccacttttcctaatcctctgcaagatcatcct
gcgtattcaactgtcaagcaatattttgtcaatgcagatgatacagtccctgaaaaggta
gttgttcagaagaacagtccacgaggagttcacttccgtcgtgctggacctcgtcagagg
gtgtattttgagtcagaagaagcgaaagcttgcattgtaacctgtggaggcctttgccct
gggctcaatactgtcatcagagagttggtttgtggcttgtcccacatgtacaacgttagc
aatgtcttcggaatacagaatgggtacaaggggttctattcgagcaattatcttcccatg
acaccaaagagtgtgaatgatatccacaaacgaggtggtacagttcttggaacatcacga
ggtggccatgataccaaaaagattgttgacaacattcaagatcgtggaattaatcaggtg
ttcattataggaggagatggaactcagaagggtgcatatgagatttacaaggaaatccgg
agacgtggtctacaagtagctgttgctggtattcccaagactattgataatgatatagcg
gttatagacaagtcatttggttttgatactgctgtagaagaagcccagcgtgccattaat
gcagctcatgtggaagcttcaagtgctgaaaatggaataggtttagtgaagcttatgggt
cgctatagtggatttattgccatgtatgctactcttgcaagcagagatgtggactgctgc
ttgattcctgagtcacccttttatttggaaggggagggtggactatttgagtatatagat
aggaggttgaaggagaacaatcacacggttattgttgtcgcggagggagcaggacaggat
cttattgctcaaagtatacctgctgcagatcagcaagatgcatctggaaataagctgctt
cttgatgttggtctctggttgactcacaagattaaggattattgcaagagcaagaagatg
gagatgactattaaatacatagatccaacttacatgatccgtgctattccaagcaatgca
tcagacaatgtctattgcaccctgctcgcacatagtgccattcatggtgcaatggcggga
tacagctttacagtcggaatggttaatggcaggcatgcatatataccatttcatagggta
acatctacaaggaacaaggtgaggataactgacaggatgtgggcgaggctgctgtcttca
accaaccaaccgagtttcctgagccagaaggacatcgacgcggccagagaagccgacaag
gcggccaaccgcatgaagagcagagaggacgcgaagaagcaatctacaccagtgttggca
aatggtgagaaatag

DBGET integrated database retrieval system