KEGG   Zea mays (maize): 100281486Help
Entry
100281486         CDS       T01088                                 

Definition
MKK4 - putative MAPKK
Orthology
K13413  
mitogen-activated protein kinase kinase 4/5, plant [EC:2.7.12.2]
Organism
zma  Zea mays (maize)
Pathway
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:zma00001]
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    100281486
Enzymes [BR:zma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100281486
Protein kinases [BR:zma01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100281486
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 352 aa AA seqDB search
MRPGGPPNSRALQPPGTPGRSRRRPDLTLPLPQRDLTSLAVPLPLPPPPSSGSLSAPASL
GAPNPPTSAGAAPPNPPPLCELERVRRVGSGAGGTVWMVRHRPTGRAYALKVLYGNHDDA
VRRQITREIAILRTAEHPAVVRCHGMYEQAGELQILLEYMDQGSLESHRIADERFLAHVA
RQVLSGIAYLHRRHIVHRDIKPSNLLIDSGRRVKIADFGVGRILNQTMDPCNSSVGTIAY
MSPERINTDLNDGAYDGYAGDIWSFGLSILEFYLGRFPLGENLGKQGDWAALMFAICYSD
SPQAPCNASPDFKNFISLCLQKNPVNRPSAMRLLQHPFVAQPQPQPLAAPPS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaggccgggcgggccgccgaactcgcgggcgctgcagccgccgggcacgccggggcgg
tcgcgccggcgcccggacctcaccctgccgctgccgcagcgggatctgacctccctcgcc
gtgcctctgcccctccctcccccgccgtcgtcggggtcgctgtcggcgccggcgtcgctc
ggcgcgccgaacccgccgacctcggccggcgccgcgccgccgaacccgccgccgctgtgc
gagctggagcgcgtgcggcgcgtcgggagcggcgcgggcgggacggtgtggatggtgcgc
caccgccccacgggccgcgcctacgcgctcaaggtgctctacggcaaccacgacgacgcg
gtgcggcggcagatcacgcgcgagatcgccatcctccgcaccgccgagcacccggccgtg
gtgcgctgccacggcatgtacgagcaggccggggagctccagatcctgctggagtacatg
gaccaggggtcgctcgagagccaccgcatcgccgacgagcgcttcctggcgcacgtggcg
cgccaggtgctgtcgggcatcgcctacctccaccgccgccacatcgtgcaccgcgacatc
aagccctccaacctgctcatcgactccggccgccgcgtcaagatcgccgacttcggcgtc
ggccgcatcctcaaccagaccatggacccctgcaactcctccgtgggcaccatcgcgtac
atgagccccgagcgcatcaacaccgacctcaacgacggcgcctacgacggctacgccggc
gacatctggagcttcggcctcagcatcctcgagttctacctgggccgcttcccgctcggc
gagaacctggggaagcagggcgactgggccgcgctcatgttcgccatctgctactccgac
tcgccgcaggcgccgtgcaacgcctcgccggacttcaagaacttcatcagcctctgccta
cagaagaacccggtgaaccgtccgtccgcgatgcggctgctgcagcacccgttcgtggcc
cagccgcagccgcagcccctggccgccccgccgtcatga

DBGET integrated database retrieval system