KEGG   Zea mays (maize): 100281515Help
Entry
100281515         CDS       T01088                                 

Definition
UBP25
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
zma  Zea mays (maize)
Brite
Enzymes [BR:zma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100281515
Peptidases [BR:zma01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100281515
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 644 aa AA seqDB search
MAPTAESSSPPPQRRPRTGPPPGLKNLSNTCYLNCVLQCLASTPPLATFCLASGHSDICK
KVSPNRDKECAFCVLERQIARLLRADAGALDSPAKVIRCMPLFAEHFRWGRQEDAHEFLR
YVVDACHTAGLRTRKLLLAKGANGNCGEDGRGQGACLVMRETFGGALLSQVKCLVCNRES
NKTDEIMDISLDLPGSSSVADALARFFKPEILEGANKYSCERCKTLTSAQKQMFMLRAPK
VLVIQLKRFEGINGGKINRNIEFKETLGISDCMYNKSQDPQPVYNLFGCIVHSGLSPESG
HYYAYVKDPSGQWFCCNDSHVSLSSSQNVLSEKVYILFYILNSKTQKSSTNGYSFTAAKP
FSTNVIDISSTSPSETSKIPLVKQNDLRLAKGNVLMPLRNGKTASGPLIKPIHFKNSAAE
KATPNGKINLTSKINPEVNETVKLSESNGCKTEHFVGPSKINANNTISCGEGGEQSERIL
QDANGNGQPIHQSQYLGETSIGNATPAQQVTSNGNATPAQQETSNGKASHAEQCFEGSSH
QKEHANSSGNKRQLEEDKFQKMLAKSASSELRLSVWMDDVYNFMRSQKRRRLLSSDVTQD
FDAMRKQLVSDSAAIFRSKVPESLMENLIKRLRSYFEGKHSPHE
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggccccgaccgcggagtcgtcttccccgccgccgcaacggcgcccccgcacgggccca
cccccggggctgaagaacctcagcaatacctgctacctcaactgcgtcctacagtgcctc
gcgtccacgccgcccctcgccacgttctgccttgcctctggccactccgacatttgcaag
aaggtgtccccgaatagggacaaggagtgcgcgttctgcgtgcttgagcggcagatcgcc
cggctgcttcgggcagatgctggggcgctcgattccccagcaaaggtaatccgctgcatg
cccctattcgctgagcacttcaggtgggggcgccaggaggatgcgcacgagttcctccgc
tatgtggtagatgcctgtcacactgctggcctccgcacgcgcaagctgctactcgctaaa
ggtgccaatggtaactgtggtgaggatggcagggggcagggggcatgtctggttatgagg
gagacatttggtggggcattgctgagtcaagtgaaatgccttgtgtgcaacagagagtct
aacaagactgatgaaataatggacatcagtctcgatctgcctgggagcagttctgttgct
gatgcccttgcccgcttctttaagccggagatattggaaggtgcaaacaaatatagttgt
gaaagatgtaaaacgctcacctcagcgcagaagcaaatgtttatgctgagggcacctaag
gtgcttgtcatacaactcaagaggtttgaggggataaatggtggaaagatcaacaggaat
atagaattcaaggagacacttggtatttctgattgcatgtacaataaaagccaggatccg
caaccagtatataacctttttggttgcatcgtccactcagggctctccccagagtctggt
cactactatgcatatgttaaggatcctagtggtcaatggttttgttgtaacgattctcat
gtctccctatcaagttctcagaatgttttgtctgagaaggtctacatcctattttatata
ctgaattcaaaaactcaaaagtctagtacaaatggttactcttttactgcagctaaacct
ttcagcaccaatgtaattgacatatcaagcacctcacctagtgagacctcgaagatacct
ttggtaaaacagaatgacctacgtcttgccaaaggtaatgtactgatgcccttgaggaat
ggcaagactgcatcaggtccacttatcaagccaattcacttcaagaatagtgcagcagaa
aaggctacaccaaatggcaaaataaacctcacttcaaaaattaatcccgaggttaatgaa
actgtgaaattatcagaatcaaatggatgcaagactgaacactttgtaggacccagtaaa
attaatgctaataatactatttcttgtggagagggaggcgaacaatcagaaagaatactg
caggatgcaaatggaaatggccagccaatccatcagtcccagtatcttggtgagaccagt
ataggcaatgctacgcctgctcaacaagtgaccagtaatggcaatgccacgcccgctcaa
caagagaccagtaatggcaaggcctcacatgctgaacaatgttttgaggggtcatctcac
caaaaagagcatgcaaactcttcaggaaacaaacgccaacttgaagaagataagtttcag
aaaatgcttgctaagtcagcttcttctgagcttcggctgtctgtatggatggatgatgtc
tataattttatgcgctcgcaaaagaggcgtcgacttctaagttcagacgttactcaagat
tttgatgcaatgagaaagcagctagtgtcagattctgcagcaatatttaggtcaaaagtt
ccggagtcactgatggaaaatctcattaaacgcctgagatcatacttcgagggcaaacat
tcaccacatgagtag

DBGET integrated database retrieval system