KEGG   Zea mays (maize): 100281695Help
Entry
100281695         CDS       T01088                                 

Gene name
pco097710
Definition
LOC100281695
Orthology
K10527  
enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
zma  Zea mays (maize)
Pathway
Fatty acid degradation
alpha-Linolenic acid metabolism
Metabolic pathways
Fatty acid metabolism
Module
beta-Oxidation
Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100281695 (pco097710)
  Lipid metabolism
   00071 Fatty acid degradation
    100281695 (pco097710)
   00592 alpha-Linolenic acid metabolism
    100281695 (pco097710)
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     100281695 (pco097710)
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     100281695 (pco097710)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100281695 (pco097710)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 727 aa AA seqDB search
MAAGSIRVTMEVGADGVALITIANPPVNALHPIIIAGLKDKYAEAMRRDDVKAIVLTGAG
GKFCGGFDINVFTKVHQTGDVSLMPDVSVELVSNMMEEGKKPSVAAIQGLALGGGLELTM
GCHARISTPEAQLGLPELTLGIIPGFGGTQRLPRLVGLPKAIEMMLQSKFIAAKEGKERG
LIDALCSPNELIKTSRLWALEIANCRKPWMRSLGRTDRLASLSEARAVLNAARQQAMKVS
PNMPQHQACLDVMEEGILYGGQAGVLKEARVFKELVVAPTSKALVHVFFAQRSTTKVPGV
TDVQLKPRPIRKVAVIGGGLMGSGIATSLLVSNISVVLKEVNPQFLQRGEKMIAGNLEGL
IKKGSLTKDRMHKAMSLFKGALDYSDFKDVDMVIEAVIEKIPLKQSIFSDIEKICPKHCI
LATNTSTIDLNVVGEKTNSQDRIIGAHFFSPAHIMPLLEIVRTEKTSPQAILDLITVGKI
IKKVPVVVGNCTGFAVNRTFFPYTQASHLLVSLGIDVFRIDRVISSFGMPMGPFQLQDVA
GYGVALAVKDIYADAFGERNLGSNLVGLMVKDGRQGKVNAKGYYIYEKGAKPKPDPSVKH
VIEEYRKQANTMPGGKPVTLMDQDILEMIFFPVVNEACRVMDENVVIRASDLDIASVLGM
GFPKYRGGLVFWADTVGAPYIHSKLSKWAEMYGPFFKPSSYLEQRAKSGVPLSAPGTSQQ
GSARSRM
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggggtcgatccgggtcaccatggaggtgggcgccgacggtgtcgcgctcata
accatcgccaacccgcccgtcaacgcgctccaccccatcatcatcgccgggctcaaggac
aagtacgcggaggccatgcgccgtgacgacgtcaaggccatcgtgctcaccggtgctgga
ggcaagttctgtggaggatttgatatcaacgttttcacaaaggttcaccagactggggat
gtatcacttatgccggacgtatctgttgagcttgtgtcaaatatgatggaagagggaaaa
aaaccttctgttgcagccattcaaggtcttgcattgggtggtggcctagagttgactatg
ggttgtcatgctcggatatctactcctgaagctcaacttggattgccagagctaaccctt
ggcatcatccctggatttggaggtactcagcgtttgccgaggcttgtaggtctacccaaa
gcgattgaaatgatgctgcaaagtaagttcattgcggcaaaggaagggaaggaacgtggt
ttgattgatgccctttgctctcctaatgaattgataaagacatcacgtctttgggctctg
gaaattgctaattgccgtaaaccttggatgagatctcttggcagaacagataggcttgct
tcactatctgaagctcgtgctgtattaaatgcagcaagacagcaagcaatgaaggtttca
ccaaacatgccacagcaccaggcctgccttgatgtaatggaagaaggcatattatatgga
ggtcaagctggtgttttgaaggaagccagggttttcaaggaactggtggtagcaccaaca
tcaaaggctcttgtccatgttttctttgcacaacgttccacgacaaaggtgccaggtgta
actgatgttcaactgaaaccaaggccaattagaaaagttgctgttattggtggtggtctg
atgggctctggaattgctacatcacttcttgttagcaatatttctgttgtgctcaaggaa
gtgaaccctcagtttctgcaaaggggagagaaaatgatagcaggtaatcttgagggcctg
ataaaaaaaggttcactaacaaaggataggatgcacaaggccatgtcgcttttcaagggc
gctttggattattcagatttcaaggatgttgatatggttattgaggctgttattgagaag
attcctttgaagcaatcgatattttctgacattgaaaaaatctgtccgaaacattgcata
cttgcgacaaacacatccaccattgatttgaatgttgttggcgagaagacaaattctcaa
gatagaattataggggctcactttttcagccctgctcatattatgcccttgcttgaaatt
gtccggacggagaagacatcaccacaagctatccttgatctcatcactgttgggaagata
ataaagaaggtccctgttgtggtcggcaactgcacaggatttgcagtcaaccgtacattt
tttccttacacacaggcttctcatcttctagttagtcttggtattgatgttttcagaatt
gatcgagtaataagcagctttggcatgccaatgggaccttttcaactccaagatgtggct
gggtatggagtggctttggcagtaaaagatatctacgctgatgcctttggagaaagaaat
ttgggctctaaccttgtgggcctgatggtaaaggatgggcgacaaggaaaggtgaatgcc
aaaggttactacatttatgagaagggtgcgaagccaaagccagaccctagtgttaagcat
gtgatcgaggagtaccgaaagcaggcaaacacaatgcctggtggaaagcctgttacttta
atggatcaagatattttggagatgattttcttcccagttgtgaatgaggcatgcagggtt
atggatgaaaatgttgtaattcgagcttccgatcttgatattgcttctgttctaggaatg
ggctttcccaaatacaggggtggtcttgtcttctgggctgacactgttggagcgccttac
atacattcgaagctaagcaagtgggccgaaatgtatggtcccttcttcaaaccttcatcg
tatttggaacaacgagctaaaagtggtgtaccattgagcgcaccaggaacatcacagcaa
ggttcggcgaggtcgcgcatgtga

DBGET integrated database retrieval system