KEGG   Zea mays (maize): 100281767Help
Entry
100281767         CDS       T01088                                 

Gene name
pco104637
Definition
LOC100281767 (EC:3.2.1.2)
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
zma  Zea mays (maize)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100281767 (pco104637)
Enzymes [BR:zma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.2  beta-amylase
     100281767 (pco104637)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 573 aa AA seqDB search
MMALNLSHQTGAAVAAAPAAPRAAVVAAAATAPRSAVVAAAATVAPPPASAPAPAPALQL
QTMTVDPAPAQAPDAVKPDLAMACQALVEAAPEAEHADVAAELRSRAGVPVFVMMPLDTV
RKDGNSLNRRKAVEASLAALKSAGVEGIMVDVWWGIAEADGPGQYNFNGYMELMEMARKT
GLKVQAVMSFHQCGGNVGDSVTIPLPGWVLEEMDKDQDLAYTDRSGRRNYEYVSLGCDAM
PVLKGRTPIQCYADFMRAFRDHFATFMGNTIVEIQVGMGPAGELRYPSYPESDGTWSFPG
IGEFQCYDRFMLSSLKAAAEAVGKPEWGNAGPGDSGSYKDWPEDTGFFRREGGWSTEYGE
FFMSWYSQMLLEHGERILSAATGVFTGSPGVKISVKVAGIHWHYGTRSHAAELTAGYYNT
RSHDGYAPIARMLARHGAVLNFTCVEMRDHEQPQDAQCRPEALVQQVAAAAREAGVGLAG
ENALPRYDDTAHDQVVATAADRAAEDRMVAFTYLRMGPDLFRPDNWRRFAAFVKRMTEPG
AREACREQVEREAEGVAHATQPLVHEAAVALTN
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgatggcgctcaacctgtcccaccagaccggcgcggccgtggcggcggcaccggcggcg
ccacgagcggccgtcgtcgcggcggcggccacggcgccacgctcggccgtcgtcgctgcg
gcggccaccgtggcgccgccgcccgcgtcggcgcccgcccccgctccggcgctccagctg
cagacgatgacggtggacccggcccccgcgcaggcgcccgacgcggtgaagccggacctc
gccatggcgtgccaggcgctggtggaggccgcgcccgaggcggagcacgccgacgtcgcc
gccgagctccggagcagggccggggtgcccgtcttcgtcatgatgccgctcgacaccgtg
cgcaaggacggcaactcgctcaaccggcgcaaggccgtggaggccagcctggcggcgctc
aagagcgccggggtggagggcatcatggtggacgtctggtggggcatcgccgaggccgac
gggcccgggcagtacaacttcaacgggtacatggagctcatggagatggccaggaagacc
gggctcaaggtccaggccgtcatgtccttccaccagtgcggcggcaacgtcggcgattca
gtcaccataccacttccgggatgggtcttggaggagatggacaaggaccaggacctggcc
tacaccgaccggagtggccgccggaactacgagtacgtctccctgggctgcgacgcgatg
cccgtgctcaagggccgcacccccatccagtgctacgccgacttcatgcgcgccttccgc
gaccacttcgccaccttcatgggcaacaccatcgtggagatccaggtcggcatgggccct
gccggcgagctgcgctacccgtcctacccggagagcgacggcacctggtcgttccctggc
atcggcgagttccagtgctacgacaggttcatgctgagtagcttgaaggcggctgctgag
gcagtgggcaagccggagtggggcaacgcgggtccgggcgactccggcagctacaaggac
tggccggaggacacgggcttcttccggcgcgagggcggctggagcacggagtacggggag
ttcttcatgagctggtactcgcagatgctcctggagcacggcgagcgcatcctgtcggcg
gcgacgggcgtgttcacggggtcccccggcgtgaagatctcggtgaaggtggccgggatc
cactggcactacggcacccggtcccacgcggcggagctgacggcggggtactacaacacc
cggtcgcacgacgggtacgcgcccatcgcgcgcatgctggcgcgccacggcgccgtgctc
aacttcacgtgcgtggagatgcgcgaccacgagcagccgcaggacgcgcagtgccgcccc
gaggcgctggtgcagcaggtggccgccgcggcgcgggaggccggcgtgggcctggccggc
gagaacgcgctgccgcgctacgacgacacggcgcacgaccaggtggtggccactgccgcc
gacagggccgccgaggaccgcatggtggccttcacgtacctgcgcatggggcccgacctg
ttccggcccgacaactggcgccgcttcgccgcgttcgtcaagcgcatgacggagccgggc
gcgcgggaggcgtgccgggagcaggtggagcgggaggccgagggcgtcgcgcacgccacc
cagcccctcgtgcacgaggccgccgtcgcgctcaccaactga

DBGET integrated database retrieval system