KEGG   Zea mays (maize): 100281767Help
Entry
100281767         CDS       T01088                                 

Gene name
pco104637
Definition
(RefSeq) beta-amylase
  KO
K01177  beta-amylase [EC:3.2.1.2]
Organism
zma  Zea mays (maize)
Pathway
zma00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100281767 (pco104637)
Enzymes [BR:zma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.2  beta-amylase
     100281767 (pco104637)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_14
Motif
Other DBs
NCBI-GeneID: 100281767
NCBI-ProteinID: NP_001148159
UniProt: B6SYP0
Position
1
AA seq 573 aa AA seqDB search
MMALNLSHQTGAAVAAAPAAPRAAVVAAAATAPRSAVVAAAATVAPPPASAPAPAPALQL
QTMTVDPAPAQAPDAVKPDLAMACQALVEAAPEAEHADVAAELRSRAGVPVFVMMPLDTV
RKDGNSLNRRKAVEASLAALKSAGVEGIMVDVWWGIAEADGPGQYNFNGYMELMEMAKKT
GLKVQAVMSFHQCGGNVGDSVTIPLPGWVLEEMDKDQDLAYTDRSGRRNYEYVSLGCDAM
PVLKGRTPIQCYADFMRAFRDHFATFMGNTIVEIQVGMGPAGELRYPSYPESDGTWSFPG
IGEFQCYDRFMLSSLKAAAEAVGKPEWGNAGPGDSGSYKDWPEDTGFFRREGGWSTEYGE
FFMSWYSQMLLEHGERILSAATGVFTGSPGVKISVKVAGIHWHYGTRSHAAELTAGYYNT
RSHDGYAPIARMLARHGAVLNFTCVEMRDHEQPQDAQCRPEALVQQVAAAAREAGVGLAG
ENALPRYDDTAHDQVVATAADRAAEDRMVAFTYLRMGPDLFQPDNWRRFAAFVKRMTEPG
AREACREQVEREAEGVAHATQPLVHEAAVALTN
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgatggcgctcaacctgtcccaccagaccggcgcggccgtggcggcggcaccggcggcg
ccacgcgcggccgtcgtcgcggcggcggccacggcgccacgctcggccgtcgtcgccgcg
gcggccaccgtggcgccgccgcccgcgtcggcgcccgcccccgctccggcgctccagctg
cagacgatgacggtggacccggcccccgcgcaggcgcccgacgcggtgaagccggacctc
gccatggcgtgccaggcgctggtggaggccgcgcccgaggcggagcacgccgacgtggcc
gccgagctccggagcagggccggggtgcccgtcttcgtcatgatgccgctcgacaccgtg
cgcaaggacggcaactcgctcaaccggcgcaaggccgtggaggccagcctggcggcgctc
aagagcgccggggtggagggcatcatggtggacgtctggtggggcatcgccgaggccgac
gggcccgggcagtacaacttcaacgggtacatggagctcatggagatggccaagaagacc
gggctcaaggtccaggccgtcatgtccttccaccagtgcggcggcaacgtcggtgattca
gtcaccataccacttccgggatgggtcttggaggagatggacaaggaccaggacctggcc
tacacggaccggagcggccgccggaactacgagtacgtctccctgggctgcgacgcgatg
cccgtgctcaagggccgcacccccatccagtgctacgccgacttcatgcgcgccttccgc
gaccacttcgccaccttcatgggcaacaccatcgtggagatccaggtcggcatgggccct
gccggcgagctgcgctacccgtcctacccggagagcgacggcacctggtcgttccctggc
atcggcgagttccagtgctacgacaggttcatgctgagtagcttgaaggcggctgctgag
gccgtgggcaagccggagtggggcaacgcgggtccgggcgactccggcagctacaaggac
tggccggaggacacgggcttcttccggcgcgagggcgggtggagcacggagtacggggag
ttcttcatgagctggtactcgcagatgctcctggagcacggcgagcgcatcctgtcggcg
gcgacgggcgtgttcacgggttcccccggcgtgaagatctcggtgaaggtggccgggatc
cactggcactacggcacccggtcccacgcggcggagctgacggcggggtactacaacacc
cggtcgcacgacgggtacgcgcccatcgcgcgcatgctggcgcgccacggcgccgtgctc
aacttcacgtgcgtggagatgcgcgaccacgagcagccgcaggacgcgcagtgccgcccc
gaggcgctggtgcagcaggtggccgccgcggcgcgggaggccggcgtgggcctggccggc
gagaacgcgctgccgcgctacgacgacacggcgcacgaccaggtggtggccacggccgcc
gacagggccgccgaggaccgcatggtggccttcacgtacctgcgcatggggcccgacctg
ttccagcccgacaactggcgccgcttcgccgcgttcgtcaagcgcatgacggagccgggc
gcgcgggaggcgtgccgggagcaggtggagcgggaggccgagggcgtcgcgcacgccacc
cagcccctcgtgcacgaggccgccgtcgcgctcaccaactga

DBGET integrated database retrieval system