KEGG   Zea mays (maize): 100282098Help
Entry
100282098         CDS       T01088                                 

Gene name
pco110886
Definition
LOC100282098 (EC:1.3.1.21)
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
zma  Zea mays (maize)
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    100282098 (pco110886)
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     100282098 (pco110886)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
Position
5
AA seq 450 aa AA seqDB search
MAKPKPSSAGAKPTAAAPPVTVHSALVTYTSMLALLSLCPPFVILLWYTMVHADGSVVRT
YEHLRDHGVLEGLKAIWPMPTLVAWKIIFGFGLFEAVLQLLLPGKRFEGPISPAGNVPVY
KANGLQAYAVTLITYLGLWWFGIFNPAIVYDHLGEIYSALVFGSFVFCIFLYIKGHVFPS
SSDSGSSGNVIIDFYWGMELYPRIGKYFDIKVFTNCRFGMMSWAVLAVTYCIKQYEMNGR
VADSMLVNTALMLIYITKFFWWESGYWCTMDIAHDRAGFYICWGCLVWVPSIYTSPGMYL
VNHPLNLGPQLALSILLAGMLCIYINYDCDRQRQEFRRTNGKCSVWGKAPSKIVASYQTT
KGETKTSLLLTSGWWGLSRHFHYVPEILSAFFWTVPALFNHFLPYFYVIFLTILLFDRAK
RDDDRCSSKYGKYWKIYCNKVPYRVIPGIY
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcccaagccttcctccgccggcgccaagccgaccgcggctgcgccaccggtt
acagtgcactcggcgctggtcacctacacctccatgctcgcgctcctctccctctgcccg
cccttcgtcatcctcctgtggtacacgatggtgcacgcggacggatcggtggtgcggact
tacgagcacctcagggatcacggcgtgctcgaggggctcaaggccatctggcccatgccc
accctcgtcgcgtggaagatcatcttcggcttcgggctcttcgaggccgtcctacagctg
ctgctccctgggaagcgcttcgaagggcccatctcgcctgccgggaacgtgccggtctac
aaggcaaatggcttacaagcatatgcagtgaccttgataacttaccttggtttgtggtgg
ttcggtatatttaaccctgcaatagtgtatgatcacttgggggagatatactctgctctt
gtttttggaagctttgtgttctgtatttttctctacataaagggccatgtatttccatct
tcatctgactctggatcctctgggaatgtgataattgacttctactggggtatggagctg
taccctcggattggcaagtactttgatatcaaagtattcaccaactgtcgtttcggtatg
atgtcctgggctgttcttgccgtaacctattgcataaagcagtatgaaatgaatggcaga
gttgctgattctatgcttgtgaatactgcacttatgttgatctatatcactaagttcttt
tggtgggaatctggatattggtgtactatggacattgctcatgatagagctggtttctat
atctgctggggatgcttggtatgggttccatccatatatacttcccctggaatgtacctt
gtaaaccaccctttgaatttgggcccccagctagcactctcaattcttctagctggaatg
ttgtgcatatacataaactatgattgtgaccgtcagcgccaagaatttcgacggacgaat
gggaaatgctcggtctggggcaaggctccatctaagattgttgcctcttatcagactaca
aagggagaaactaaaaccagtcttctcttgacttctggatggtggggcttgtcacgtcac
ttccactatgtcccagagatactatctgcatttttctggactgttccagctcttttcaat
cacttcctaccatacttctacgtgatctttctgactatattattgtttgaccgagcaaag
agggatgatgaccggtgctcatcaaagtacgggaagtactggaagatttactgcaacaaa
gtaccatacagagtcattcctggcatttactga

DBGET integrated database retrieval system