KEGG   Zea mays (maize): 100282296Help
Entry
100282296         CDS       T01088                                 

Gene name
PDIL5-3
Definition
protein disulfide isomerase
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
zma  Zea mays (maize)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:zma00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100282296 (PDIL5-3)
Enzymes [BR:zma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100282296 (PDIL5-3)
Exosome [BR:zma04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100282296 (PDIL5-3)
  Exosomal proteins of colorectal cancer cells
   100282296 (PDIL5-3)
  Exosomal proteins of bladder cancer cells
   100282296 (PDIL5-3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 383 aa AA seqDB search
MALRRLLLPLLLLVLLGLRPQSCVASGGGGGEPAEFEIPRDGSVLELDESNFEAAVRAAE
FLFVDFYAPWCGHCKRLAPQLDEAAAVLAGLSTPVLVAKVNADKYKKLGSKYGVDGFPTL
MFFDHGVPSEYTGSRKADVLVENLKKLVAPDVSVLESDSSINGFVQAAGINFPLFIGFGM
DESLIVEYGAKYKKKAWFSTAKDFSEDVMVVYDFDKVPALVSVNPKYNEQSVFYGPFEGT
FLEDFIRQSLLPATVPINRETVKLLKDDGRKVVLTILEDESDESSLQLIKVLRSAANANH
DLVFGYVGVKQWEEFTETFDVKVSQLPKIVVWDTKEEYEVVEGSESFIEGDYGSQVSRFL
EGYREGRTTKEESGPWFPNTARP
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcgtcggctgctgcttcctctcctcctcctcgtactcttaggtctgcggccg
cagagctgcgtcgccagtggcggaggtggaggggagccggcggagttcgagatacctcgg
gacgggagcgtgctggagcttgacgagagcaacttcgaggcggcggtgcgcgcagccgaa
ttcctcttcgtcgacttctacgctccctggtgcggccactgcaagcgcctcgccccgcag
ttagatgaggctgctgcagtgctagctggactgagcacgcccgtccttgtggctaaagta
aatgctgacaaatacaagaagctcggctctaaatatggagtagatgggttccctactttg
atgttttttgaccatggagtgccctcggagtacacgggttcaaggaaggctgatgtgcta
gttgagaaccttaagaagcttgttgcacctgatgtttctgtccttgagtcggactcgtca
attaacggctttgttcaagcagctggcatcaattttccattgtttattgggtttggaatg
gatgagtcattgattgttgaatatggagcgaagtacaagaagaaggcatggttttcaaca
gcaaaggatttctctgaggatgtgatggttgtgtatgattttgacaaggttccagcgttg
gtttctgttaacccaaaatataatgagcagagtgtattctatggcccgtttgaaggaact
tttctggaagattttataaggcaatccctactgcctgcaactgtgcccatcaatagagag
acagtaaagctattgaaagatgatgggaggaaagttgttcttacaatcttggaggatgaa
tcagatgaaagctctctgcagctaataaaagtgttgaggtctgccgccaatgcaaaccat
gatttagtgttcggatatgtgggagtcaaacagtgggaggagttcaccgagacttttgat
gtgaaggtttcgcagctgccaaagattgttgtctgggacacaaaagaggagtacgaagtg
gttgagggttcagagagtttcatagaaggtgactatggatcccaagtcagtcgatttcta
gagggatatagggaaggaagaacaaccaaagaagaaagtgggccgtggttccccaacact
gctcggccttaa

DBGET integrated database retrieval system