KEGG   Zea mays (maize): 100282385Help
Entry
100282385         CDS       T01088                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 6
  KO
K11843  ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
zma  Zea mays (maize)
Brite
Enzymes [BR:zma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100282385
Peptidases [BR:zma01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100282385
Ubiquitin system [BR:zma04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100282385
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 ubiquitin Peptidase_C98
Motif
Other DBs
NCBI-GeneID: 100282385
NCBI-ProteinID: NP_001148768
UniProt: B6T6V5
Position
3
AA seq 478 aa AA seqDB search
MPTVSVKWQKELFPGIEIDTSQPPIVFKTQLYTLTGVPPERQKIMVKGGILKDDADWSTL
GVKDGQKLMMIGTADEIVKAPEKGPVFVEDLPEEEQVIALGHSAGLYNLGNTCYMNSTLQ
CLHSVPELKSALLSYSDTVRGNGIDQASHNLTVATRNTFGDLDQSVRPVAPLQFLQTLRK
KYPQFAQQHNNVYMQQDAEECWTQLVYTLSQTLTSDSSESAALPMKQLFGIDLVSRVHCA
ESGEESMETESVYSLKCHISQDVNHLHEGIKHGLKTELEKASPTLGRTAVYTRESRINEL
PRYLTVQFVRFFWKRESNQKAKILRKVDYPLELDVYEFCSDELKQKLQAPRQMLRDAENA
KFGLKAQGKASGFKENEGSSSSAGESSSMDIDKAESSLPKKQLTGVYDLVAVLTHKGRSA
DSGHYVGWVKQDDGKWIEFDDDNPNIRKEEDILKLSGGGDWHMAYICLYKARMAELKS
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccgtaagcgtgaaatggcagaaggagctctttccaggcatagagattgacact
agccagcctccgattgttttcaagactcagttgtacacactaactggtgtgccacctgaa
cgccaaaaaattatggtgaagggaggaatattgaaggacgatgcagattggtctactttg
ggagtgaaagatggccaaaagttgatgatgataggcacggctgatgagattgtgaaagct
ccggagaaaggtccagtgtttgttgaggatctaccagaagaagagcaagtgattgcactg
ggtcacagtgctggtctttataaccttgggaatacatgctatatgaattccacattgcaa
tgtctgcattctgttccagagctgaagtcagcgctgctaagctattcagatactgtaaga
ggtaatggcattgaccaagcttctcataatttgactgttgctactcgtaatacctttggt
gatcttgatcaaagtgttcgccctgttgcacctctacaattcttgcagacactgcgtaaa
aaatacccgcaatttgcgcagcagcataataatgtctacatgcaacaggatgcagaagaa
tgctggacacagttggtgtatacgctttctcaaactcttacctcagattcaagtgaatct
gcagctcttccgatgaagcaactatttgggatagatctcgtgagcagggtccactgtgca
gaaagtggtgaggagagcatggagacagaatcagtatattcccttaagtgtcatatatct
caagatgtgaaccatcttcatgagggaattaagcatggcttgaagacagaacttgagaaa
gcttcacctacactgggtcgaactgcagtttatactagagaatcaagaataaatgagctg
cctaggtacttgactgtgcagttcgttcgcttcttttggaaaagggaatcaaaccaaaag
gcaaagattttacgaaaagttgattacccactggaattggatgtttatgaattttgctct
gatgaactgaaacagaaactccaagcacctcggcagatgctgagagatgcagaaaatgca
aagtttggattgaaagcacaagggaaagctagtggctttaaagaaaatgagggatcatcc
agtagcgctggggaatcatccagtatggacattgacaaagctgagtcttctctaccaaag
aaacaattaactggcgtctatgatttggttgctgtcttgacacacaagggaagaagtgca
gactctggccactatgttggctgggtaaagcaagatgacggaaaatggatcgagtttgat
gatgacaatccaaacatccgcaaggaggaagacattttgaaactatctggtggaggtgac
tggcacatggcttatatctgcctatacaaagcccgcatggcggagttgaagagttag

DBGET integrated database retrieval system