KEGG   Zea mays (maize): 100282385Help
Entry
100282385         CDS       T01088                                 

Definition
ubiquitin carboxyl-terminal hydrolase 6 (EC:3.1.2.15)
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
zma  Zea mays (maize)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 478 aa AA seqDB search
MPTVSVKWQKELFPGIEIDTSQPPIVFKTQLYTLTGVPPERQKIMVKGGILKDDADWSTL
GVKDGQKLMMIGTADEIVKAPEKGPVFVEDLPEEEQVIALGHSAGLYNLGNTCYMNSTLQ
CLHSVPELKSALLSYSDTVRGNGIDQASHNLTVATRNTFGDLDQSVRPVAPLQFLQTLRK
KYPQFAQQHNNVYMQQDAEECWTQLVYTLSQTLTSDSSESAALPMKQLFGIDLVSRVHCA
ESGEESMETESVYSLKCHISQDVNHLHEGIKHGLKTELEKASPTLGRTAVYTRESRINEL
PRYLTVQFVRFFWKRESNQKAKILRKVDYPLELDVYEFCSDELKQKLQAPRQMLRDAENA
KFGLKAQGKASGFKENEGSSSSAGESSSMDIDKAESSLPKKQLTGVYDLVAVLTHKGRSA
DSGHYVGWVKQDDGKWIEFDDDNPNIRKEEDILKLSGGGDWHMAYICLYKARMAELKS
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccgtaagcgtgaaatggcagaaggagctctttccaggcatagagattgacact
agccagcctccgattgttttcaagactcagttgtacacactaactggtgtgccacctgaa
cgccaaaaaattatggtgaagggaggaatattgaaggacgatgcagattggtctactttg
ggagtgaaagatggccaaaagttgatgatgataggcacggctgatgagattgtgaaagct
ccggagaaaggtccagtgtttgttgaggatctaccagaagaagagcaagtgattgcactg
ggtcacagtgctggtctttataaccttgggaatacatgctatatgaattccacattgcaa
tgtctgcattctgttccagagctgaagtcagcgctgctaagctattcagatactgtaaga
ggtaatggcattgaccaagcttctcataatttgactgttgctactcgtaatacctttggt
gatcttgatcaaagtgttcgccctgttgcacctctacaattcttgcagacactgcgtaaa
aaatacccgcaatttgcgcagcagcataataatgtctacatgcaacaggatgcagaagaa
tgctggacacagttggtgtatacgctttctcaaactcttacctcagattcaagtgaatct
gcagctcttccgatgaagcaactatttgggatagatctcgtgagcagggtccactgtgca
gaaagtggtgaggagagcatggagacagaatcagtatattcccttaagtgtcatatatct
caagatgtgaaccatcttcatgagggaattaagcatggcttgaagacagaacttgagaaa
gcttcacctacactgggtcgaactgcagtttatactagagaatcaagaataaatgagctg
cctaggtacttgactgtgcagttcgttcgcttcttttggaaaagggaatcaaaccaaaag
gcaaagattttacgaaaagttgattacccactggaattggatgtttatgaattttgctct
gatgaactgaaacagaaactccaagcacctcggcagatgctgagagatgcagaaaatgca
aagtttggattgaaagcacaagggaaagctagtggctttaaagaaaatgagggatcatcc
agtagcgctggggaatcatccagtatggacattgacaaagctgagtcttctctaccaaag
aaacaattaactggcgtctatgatttggttgctgtcttgacacacaagggaagaagtgca
gactctggccactatgttggctgggtaaagcaagatgacggaaaatggatcgagtttgat
gatgacaatccaaacatccgcaaggaggaagacattttgaaactatctggtggaggtgac
tggcacatggcttatatctgcctatacaaagcccgcatggcggagttgaagagttag

DBGET integrated database retrieval system