KEGG   Zea mays (maize): 100282423Help
Entry
100282423         CDS       T01088                                 

Gene name
IDP92
Definition
LOC100282423
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
zma  Zea mays (maize)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 197 aa AA seqDB search
MEPGAKSEAKQGEAGSGAGESGSGKVYHERQRLQFCLLHALNNLMQEKECFTRAELDGIA
GNLVLNDPNKGQWTPLPFIFKPHHNVITGNYDVNVLITALEARNKKVVWHDRRKGASSVD
LNAETLVGLVINVPIRRFRGLWTGRHWVAIRRIDGIWFNLDSDLSEPKQFKDQENVIGFL
DSVLSQGGELMVVLQGE
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggaaccgggagccaaatcggaagcaaagcaaggtgaggcaggatctggcgcgggggaa
agcggcagcggcaaggtgtatcatgagaggcagaggctgcaattctgtctcctccatgct
ctcaacaaccttatgcaggaaaaggaatgtttcacccgtgctgagttggacggcatcgct
ggaaatcttgttctcaatgatccaaacaagggccagtggactcctctaccattcattttt
aaacctcaccacaatgttataactgggaactatgatgtgaatgttctcatcacagcatta
gaagctagaaacaagaaggtggtttggcatgatcgtcgtaaaggggcatcatcggttgat
ctgaatgcagaaacattggtaggcctggtgatcaatgtacctatcaggaggttcaggggg
ctttggactggcaggcattgggtggcaattcgacgcattgatggcatctggtttaatttg
gacagtgatctttctgaacccaagcagtttaaggaccaagaaaacgtgattgggttcctt
gacagtgtgctcagccaaggtggagaactcatggttgtgctgcaaggtgaataa

DBGET integrated database retrieval system