KEGG   Zea mays (maize): 100282423Help
Entry
100282423         CDS       T01088                                 

Gene name
IDP92
Definition
LOC100282423
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
zma  Zea mays (maize)
Brite
Enzymes [BR:zma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100282423 (IDP92)
Peptidases [BR:zma01002]
 Cysteine Peptidases
  Family C86
   100282423 (IDP92)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
Position
1
AA seq 197 aa AA seqDB search
MEPGAKSEAKQGEAGSGAGESGSGKVYHERQRLQFCLLHALNNLMQEKECFTRAELDGIA
GNLVLNDPNKGQWTPLPFIFKPHHNVITGNYDVNVLITALEARNKKVVWHDRRKGASSVD
LNAETLVGLVINVPIRRFRGLWTGRHWVAIRRIDGIWFNLDSDLSEPKQFKDQENVIGFL
DSVLSQGGELMVVLQGE
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggaaccgggagccaaatcggaagcaaagcaaggtgaggcaggatctggcgcgggggaa
agcggcagcggcaaggtgtatcatgagaggcagaggctgcaattctgtctcctccatgct
ctcaacaaccttatgcaggaaaaggaatgtttcacccgtgctgagttggacggcatcgct
ggaaatcttgttctcaatgatccaaacaagggccagtggactcctctaccattcattttt
aaacctcaccacaatgttataactgggaactatgatgtgaatgttctcatcacagcatta
gaagctagaaacaagaaggtggtttggcatgatcgtcgtaaaggggcatcatcggttgat
ctgaatgcagaaacattggtaggcctggtgatcaatgtacctatcaggaggttcaggggg
ctttggactggcaggcattgggtggcaattcgacgcattgatggcatctggtttaatttg
gacagtgatctttctgaacccaagcagtttaaggaccaagaaaacgtgattgggttcctt
gacagtgtgctcagccaaggtggagaactcatggttgtgctgcaaggtgaataa

DBGET integrated database retrieval system