KEGG   Zea mays (maize): 100282482Help
Entry
100282482         CDS       T01088                                 

Definition
aspartate carbamoyltransferase 1
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
zma  Zea mays (maize)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    100282482
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100282482
Enzymes [BR:zma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     100282482
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 369 aa AA seqDB search
MVSTARAALPTPHLSLASSSRRRPHLFFTPSSAPRLRGGAATSITAGSSASPQQHQVTTR
LGDVIEAQQFDRDSLNEIFEVAREMEAVERSSHGAPSRVLEGYLMATLFYEPSTRTRLSF
EAAMRRLGGEVLTTENAREFSSAAKGETLEDTIRTVEGYSDIIVLRHFESGAARRAAYTA
NIPVINAGDGPGQHPTQALLDVYTIKREIGTLDGIKLGLVGDLANGRTVRSLAYLIAKYQ
NIKIYFVSPDVVKMKDDIKDYLNSQGVEWEECSDLLEVASKCDVIYQTRIQKERFGERID
LYKAARGKYIVDKKVLDVLPKHAVIMHPLPRLDEITAEVDSDPRAAYFRQAKNGLYIRMA
LLKLLLVGH
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggtctccaccgctcgcgccgccctcccgacgccccacctctctctcgcttcctcctcc
cgccgcaggccccatctgtttttcacgccctcctccgcacctcgcctgcgcggcggcgct
gccacctccatcaccgccggcagctccgcctcgccgcagcagcaccaggtcaccacgcgc
ctgggcgacgtgatagaggcgcagcagttcgatcgggactcgcttaacgagatctttgag
gtggcgcgggagatggaggccgtggagcggagctcccacggcgctcccagtcgcgtcctc
gaggggtacctcatggccactctcttctacgagccctccacgcgcacgcgcctctccttc
gaggccgctatgcggaggctcggcggggaggtgctcaccaccgagaacgcgcgcgagttc
tcttccgccgccaagggggagacactcgaagataccataagaaccgttgagggttattct
gatattattgttctgagacattttgaaagtggagctgcaaggagagcagcatatactgcg
aatattcctgttattaatgcaggtgatgggccagggcaacatccaacccaggctttgttg
gatgtttatacaataaagagagaaattggcacactagatggaataaaacttggtttggtt
ggtgaccttgctaatgggaggacagttcgttctctggcttacttgattgctaagtaccag
aacattaagatatactttgtatctccagatgttgttaaaatgaaggatgatatcaaggac
tacttaaattcccaaggtgttgaatgggaagaatgttcagatttgttggaggtggcatcc
aagtgtgatgttatttatcaaacacgtattcaaaaagaaagatttggtgagaggattgat
ctttataaagctgctcgtggtaagtacattgtggataagaaggtcttagatgtgctgcca
aagcatgctgtgatcatgcatccccttccaaggcttgatgagatcacggcagaagtcgat
agtgatccaagagctgcatattttaggcaggctaagaatggcctctacataaggatggca
ttgctcaaacttctgcttgttggtcactga

DBGET integrated database retrieval system