KEGG   Zea mays (maize): 100282642Help
Entry
100282642         CDS       T01088                                 

Definition
(RefSeq) chalcone synthase WHP1
  KO
K00660  chalcone synthase [EC:2.3.1.74]
Organism
zma  Zea mays (maize)
Pathway
zma00941  Flavonoid biosynthesis
zma01100  Metabolic pathways
zma01110  Biosynthesis of secondary metabolites
zma04712  Circadian rhythm - plant
Module
zma_M00137  Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    100282642
 Organismal Systems
  Environmental adaptation
   04712 Circadian rhythm - plant
    100282642
Enzymes [BR:zma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.74  naringenin-chalcone synthase
     100282642
Polyketide biosynthesis proteins [BR:zma01008]
 Polyketide synthase (PKS)
  Type III PKS
   Plant type
    100282642
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Chal_sti_synt_N Chal_sti_synt_C ACP_syn_III ACP_syn_III_C FAE1_CUT1_RppA
Motif
Other DBs
NCBI-GeneID: 100282642
NCBI-ProteinID: NP_001149022
UniProt: B6T9S4
Position
2
AA seq 401 aa AA seqDB search
MAGATVTVDEVRKGQRATGPATVLAIGTATPANCVYQADYPDYYFRITKSDHLTDLKEKF
KRMCDKSMIRKRYMHLTEEFLSENPSMCAYMAPSLDARQDVVVTEVPKLGKAAAQKAIKE
WGQPKSRITHLVFCTTSGVDMPGADYQLTKALGLRPSVNRLMMYQQGCFAGGTVLRVAKD
LAENNRGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAVVVGADPDGRVERPL
FQLVSAAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIERALEDAFEPLGISDWN
SIFWVAHPGGPAILDQVEARVGLDKARMRATRHVLSEYGNMSSACVLFILDEMRKRSAED
GQATTGEGLDWGVLFGFGPGLTVETVVLHSVPITTGAPTAA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggccggcgccaccgtgaccgtggacgaggtgaggaagggccagcgcgcgaccggcccc
gccaccgtgctggccatcgggacggcgacgcccgccaactgcgtgtaccaggccgactac
ccggactactacttccggatcaccaagagcgaccacctcaccgacctcaaggagaagttc
aagaggatgtgcgacaagtcgatgatccggaagcggtacatgcacctgacggaggagttc
ctgtcggagaacccgagcatgtgcgcgtacatggcgccgtcgctggacgcgcggcaggac
gtggtggtgacggaggtgccgaagctggggaaggcggcggcgcagaaggcgatcaaggag
tgggggcagcccaagtcgcggatcacgcacctggtgttctgcaccacgtcgggggtggac
atgccgggcgccgactaccagctgaccaaggcgctggggctgcgcccgtccgtgaaccgc
ctgatgatgtaccagcaggggtgcttcgcgggcggcacggtgctgcgcgtggccaaggac
ctggcggagaacaaccgcggggcgagggtcctggtggtgtgctcggagatcacggccgtg
acgttccgcgggccgtccgagtcgcacctggactcgctcgtggggcaggcgctgttcggc
gacggcgcggcggccgtcgtggtgggcgccgacccggacgggcgggtcgagcgcccgctg
ttccagctcgtgtcggcggcgcagaccatcctgcccgactcggagggcgccatcgacggc
cacctccgcgaggtggggctgacgttccacctgctcaaggacgtgcccgggctcatctcc
aagaacatcgagcgcgcgctggaggacgcgttcgagccgctcggcatctccgactggaac
tccatcttctgggtggcgcaccccggcgggcccgccatcctggaccaggtggaggccagg
gtcgggctggacaaggccaggatgcgcgccacccgccacgtcctctccgagtacggcaac
atgtccagcgcctgcgtgctcttcatcctggacgagatgcgcaagcgctccgccgaggac
ggccaggccaccaccggcgaggggctcgactggggcgtcctcttcggcttcggcccgggc
ctcaccgtcgagaccgtcgtgctccacagcgtccccatcaccaccggagcgcccaccgcc
gcctga

DBGET integrated database retrieval system