KEGG   Zea mays (maize): 100282642Help
Entry
100282642         CDS       T01088                                 

Definition
chalcone synthase (EC:2.3.1.74)
Orthology
K00660  
chalcone synthase [EC:2.3.1.74]
Organism
zma  Zea mays (maize)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    100282642
 Organismal Systems
  Environmental adaptation
   04712 Circadian rhythm - plant
    100282642
Enzymes [BR:zma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.74  naringenin-chalcone synthase
     100282642
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 401 aa AA seqDB search
MAGATVTVDEVRKGQRATGPATVLAIGTATPANCVYQADYPDYYFRITKSDHLTDLKEKF
KRMCDKSMIRKRYMHLTEEFLSENPSMCAYMAPSLDARQDVVVTEVPKLGKAAAQKAIKE
WGQPKSRITHLVFCTTSGVDMPGADYQLTKALGLRPSVNRLMMYQQGCFAGGTVLRVAKD
LAENNRGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAVVVGADPDGRVERPL
FQLVSAAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIERALEDAFEPLGISDWN
SIFWVAHPGGPAILDQVEARVGLDKARMRATRHVLSEYGNMSSACVLFILDEMRKRSAED
GQATTGEGLDWGVLFGFGPGLTVETVVLHSVPITTGAPTAA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggccggcgccaccgtgaccgtggacgaggtgaggaagggccagcgcgcgaccggcccc
gccaccgtgctggccatcgggacggcgacgcccgccaactgcgtgtaccaggccgactac
ccggactactacttccggatcaccaagagcgaccacctcaccgacctcaaggagaagttc
aagaggatgtgcgacaagtcgatgatccggaagcggtacatgcacctgacggaggagttc
ctgtcggagaacccgagcatgtgcgcgtacatggcgccgtcgctggacgcgcggcaggac
gtggtggtgacggaggtgccgaagctggggaaggcggcggcgcagaaggcgatcaaggag
tgggggcagcccaagtcgcggatcacgcacctggtgttctgcaccacgtcgggggtggac
atgccgggcgccgactaccagctgaccaaggcgctggggctgcgcccgtccgtgaaccgc
ctgatgatgtaccagcaggggtgcttcgcgggcggcacggtgctgcgcgtggccaaggac
ctggcggagaacaaccgcggggcgagggtcctggtggtgtgctcggagatcacggccgtg
acgttccgcgggccgtccgagtcgcacctggactcgctcgtggggcaggcgctgttcggc
gacggcgcggcggccgtcgtggtgggcgccgacccggacgggcgggtcgagcgcccgctg
ttccagctcgtgtcggcggcgcagaccatcctgcccgactcggagggcgccatcgacggc
cacctccgcgaggtggggctgacgttccacctgctcaaggacgtgcccgggctcatctcc
aagaacatcgagcgcgcgctggaggacgcgttcgagccgctcggcatctccgactggaac
tccatcttctgggtggcgcaccccggcgggcccgccatcctggaccaggtggaggccagg
gtcgggctggacaaggccaggatgcgcgccacccgccacgtcctctccgagtacggcaac
atgtccagcgcctgcgtgctcttcatcctggacgagatgcgcaagcgctccgccgaggac
ggccaggccaccaccggcgaggggctcgactggggcgtcctcttcggcttcggcccgggc
ctcaccgtcgagaccgtcgtgctccacagcgtccccatcaccaccggagcgcccaccgcc
gcctga

DBGET integrated database retrieval system