KEGG   Zea mays (maize): 100282738Help
Entry
100282738         CDS       T01088                                 

Definition
(RefSeq) apospory-associated protein C
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
zma  Zea mays (maize)
Pathway
zma00010  Glycolysis / Gluconeogenesis
zma01100  Metabolic pathways
zma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100282738
Enzymes [BR:zma01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     100282738
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 100282738
NCBI-ProteinID: NP_001149116
UniProt: B4G1N6
Position
3
AA seq 316 aa AA seqDB search
MSMGHCSEQRTGFEVTKDWNGADQFAIRSPRGASVRVCLHGGQVVSWRNHRGEELLFSSS
KAIFKPPRATRGGIPICFPQFGNCGTLEQHGFARNKIWTIDDEAPPLNYGDNNSNKASVD
LLLKPSEDDLKCWPHCFELRLRVSLSMDGDLSLISRVRNVNGKPFSFAFAYHTYLSVSDI
SEVRIEGLETLDYLDNLSQRERFTEQGDAITFESEVDRVYVGCPGVIAVLDHGKKRTFIV
RKEGLPDIVVWNPWEKKSKTMADFGDDEYKQMLCVDAAAVERAITLKPGEEWTGKLELSA
VASTNCSDHLDRPGRL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagcatggggcattgctccgagcagcggacggggttcgaggtgactaaggactggaac
ggcgccgaccagttcgcgatccggtccccgcggggggcgtccgttcgggtctgcctgcac
ggcgggcaggtcgtctcgtggaggaaccaccgcggcgaggagctcctcttcagcagcagc
aaggcaatcttcaagccgccaagagcgacccgtggtggcattccgatatgcttcccacag
tttggaaactgtggaacattggagcagcatggatttgcaaggaacaagatatggacaata
gacgatgaggctccacctctaaattatggtgataataacagcaacaaagcttctgttgac
cttctgctaaagccatctgaagatgacctgaagtgctggccacactgttttgagttacgt
ctcagagtctctctttcaatggatggagacctttcactgatatcacgggtcagaaatgtt
aatgggaagccattcagtttcgcatttgcttaccatacatacctttctgtttctgacatc
agtgaagtgaggatagaaggtctggagacccttgattatcttgacaaccttagccagcgg
gaacgttttaccgaacagggagatgccataacatttgaatcagaggttgatcgagtctat
gttggctgcccaggcgtaatagctgttcttgaccatggaaagaaacgcacattcatcgtg
cggaaagaagggcttcctgatattgttgtgtggaacccctgggagaagaagtccaagacg
atggcagacttcggcgacgacgagtacaagcagatgctgtgcgtggatgcagccgcggtc
gagagggccatcacgctgaagcccggggaggagtggacggggaagctggagctctccgcc
gtggcgtcgaccaactgcagcgaccacctggatcgcccgggcaggctgtag

DBGET integrated database retrieval system