KEGG   Zea mays (maize): 100282738Help
Entry
100282738         CDS       T01088                                 

Definition
apospory-associated protein C
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
zma  Zea mays (maize)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:zma00010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 316 aa AA seqDB search
MSMGHCSEQRTGFEVTKDWNGADQFAIRSPRGASVRVCLHGGQVVSWRNHRGEELLFSSS
KAIFKPPRATRGGIPICFPQFGNCGTLEQHGFARNKIWTIDDEAPPLNYGDNNSNKASVD
LLLKPSEDDLKCWPHCFELRLRVSLSMDGDLSLISRVRNVNGKPFSFAFAYHTYLSVSDI
SEVRIEGLETLDYLDNLSQRERFTEQGDAITFESEVDRVYVGCPGVIAVLDHGKKRTFIV
RKEGLPDIVVWNPWEKKSKTMADFGDDEYKQMLCVDAAAVERAITLKPGEEWTGKLELSA
VASTNCSDHLDRPGRL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagcatggggcattgctccgagcagcggacggggttcgaggtgactaaggactggaac
ggcgccgaccagttcgcgatccggtccccgcggggggcgtccgttcgggtctgcctgcac
ggcgggcaggtcgtctcgtggaggaaccaccgcggcgaggagctcctcttcagcagcagc
aaggcaatcttcaagccgccaagagcgacccgtggtggcattccgatatgcttcccacag
tttggaaactgtggaacattggagcagcatggatttgcaaggaacaagatatggacaata
gacgatgaggctccacctctaaattatggtgataataacagcaacaaagcttctgttgac
cttctgctaaagccatctgaagatgacctgaagtgctggccacactgttttgagttacgt
ctcagagtctctctttcaatggatggagacctttcactgatatcacgggtcagaaatgtt
aatgggaagccattcagtttcgcatttgcttaccatacatacctttctgtttctgacatc
agtgaagtgaggatagaaggtctggagacccttgattatcttgacaaccttagccagcgg
gaacgttttaccgaacagggagatgccataacatttgaatcagaggttgatcgagtctat
gttggctgcccaggcgtaatagctgttcttgaccatggaaagaaacgcacattcatcgtg
cggaaagaagggcttcctgatattgttgtgtggaacccctgggagaagaagtccaagacg
atggcagacttcggcgacgacgagtacaagcagatgctgtgcgtggatgcagccgcggtc
gagagggccatcacgctgaagcccggggaggagtggacggggaagctggagctctccgcc
gtggcgtcgaccaactgcagcgaccacctggatcgcccgggcaggctgtag

DBGET integrated database retrieval system