KEGG   Zea mays (maize): 100282752Help
Entry
100282752         CDS       T01088                                 

Gene name
pco070011
Definition
LOC100282752
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
zma  Zea mays (maize)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100282752 (pco070011)
Enzymes [BR:zma01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     100282752 (pco070011)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 332 aa AA seqDB search
MAGPAPAVAASAAASQSPPMQLPSPFAXLVKGSSGLEKIVLRGARNCCAEIYLYGGQVTS
WKNDNGEELLFLSSKAIFKPPKAIRGGIPICFPQFGTHGNLEQHGFARNRFWTIDNNPPP
LPVNPAIKAYVDLILKPSEEDLKIWPHSFEFRLRVSLGPSGDLSLTSRIRNTNTDGRPFS
YTFAYHTYFSVSDISEVRVEGLETMDYLDNLKAKERFTEQGDAIVFESEVDKVYLAAPSK
IAIIDHEKKRTFVVTKEGLPDAVVWNPWDKKAKAMQDFGDAEYKSMLCVEPAAVERPITL
KPGEEWKGRLVLSAVPSSYCSGQLDPSKVLQG
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggccggccctgcccccgccgttgcagccagtgccgccgcctcacagtcgccgccgatg
cagctgccgtcgccgttcgcggasctagtcaagggttcctccggcctcgagaagatcgtg
cttcgcggcgctcgcaactgctgtgccgagatctatctttatggaggtcaagtaacatca
tggaagaatgacaatggggaagagttgctttttctcagcagcaaggctattttcaaacct
ccaaaagctattcgtggtggtataccaatttgctttccccaatttggaacacatggaaat
cttgagcaacatggatttgctaggaaccggttttggactatcgacaacaacccaccccct
ttaccagtaaaccctgctattaaggcttatgttgatctgattttgaagccttctgaagag
gatttaaagatctggccccacagttttgaatttcgcttgagagtttctcttggaccttct
ggagatctgagtctcacatcccgaatcaggaataccaacacagatggaagacctttctct
tatacatttgcatatcacacatacttctctgtctctgacataagcgaggtgcgtgtcgaa
gggctggaaacaatggactaccttgacaacttgaaggcaaaggagcgtttcacggagcaa
ggcgatgctattgtttttgaatcagaagttgataaagtttatcttgccgcaccctctaaa
attgccatcattgatcatgagaagaaaagaacatttgtcgtgacaaaagaagggcttcct
gatgctgttgtttggaacccttgggacaagaaggcaaaagcaatgcaagattttggggat
gcagaatacaagagcatgctgtgtgtggagcctgcagctgttgagaggcctattactctg
aaacctggggaagagtggaaaggaaggcttgtgctttcagctgttccttcgagttactgt
agcggacagttagatccatcgaaggtccttcagggttga

DBGET integrated database retrieval system