KEGG   Zea mays (maize): 100282760Help
Entry
100282760         CDS       T01088                                 

Gene name
umc2169
Definition
LOC100282760
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
zma  Zea mays (maize)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    100282760 (umc2169)
Enzymes [BR:zma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     100282760 (umc2169)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
Position
3
AA seq 404 aa AA seqDB search
MACSAHLVSQSLYSSHRASPGGPRNLRSQGRPPARASPSARPGSRVSGCRGVSLRVAASF
EQGRRQVEVSYDPQARFNQIADQIDKDAGMTRLNLFSPCKINVFLRITGKRPDGFHDLAS
LFHVISLGDTIKFSLSPSKSRDRLSTNVPGVPVDESNLIIKALNLYRQKTGTNNFFWIHL
DKKVPTGAGLGGGSSNAATALWAANQFAGCIASEKDLQEWSGEIGSDIPFFFSRGAAYCT
GRGEIVQDIPNPLPENLPMVLIKPPEACSTAEVYKRFRLEQTSQADPMTLLEEITQNGIS
QDVCVNDLEPPAFEVLPSLKRLKKRIIAAGRDDYSAVFMSGSGSTIVGIGSPDPPAFVYD
DEDYKDVFVSEACLLTRDENEWYREPISANATSGKEGLQASVAD
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcttgctccgcgcaccttgtgtcccagagcctctactcgtcccaccgcgccagcccg
ggcgggcctaggaatctccgttcccagggccgaccgccggcgcgggcgtctccctctgcg
aggcctggctcaagggtcagtggctgccggggtgtcagcctgagagtcgccgcgtcgttc
gagcagggaaggaggcaagtggaggtctcttatgacccacaagcgaggtttaaccagata
gcagaccaaattgacaaggatgctgggatgacacggcttaacctattctcaccttgcaaa
attaatgtgttcttgaggataacgggcaagagaccagatgggttccatgacctggcttct
ctatttcatgtcataagtttgggtgatactatcaaattctcattgtcaccaagtaaaagt
agagatcgcctgtcaaccaatgttccaggtgtcccagttgatgaaagcaatttgatcatc
aaggcactcaacctttaccgacagaaaactgggactaataacttcttctggatacatctt
gataagaaggtcccaactggtgctggtcttggtggtggaagcagtaatgctgcaactgca
ctatgggccgctaaccagtttgctggctgcatagcttcagagaaggatcttcaagagtgg
tctggtgagattggatcagatatcccctttttcttttcacgaggagcagcatattgtaca
ggtagaggagagattgtccaagatatcccaaatcccttgccggaaaatttaccaatggtt
cttataaagccacctgaagcatgctcaactgctgaagtttacaagcgattcaggttggaa
caaacaagtcaagctgatcccatgaccctgctcgaggaaataactcagaatgggatatca
caagatgtttgtgttaatgacctagagcctccagcttttgaggtgttgccctcacttaag
aggttgaagaaacgaattattgcagctggccgggatgattatagtgctgtttttatgtca
ggaagtggaagcacaattgttggtattggttcaccggatcctcctgcattcgtgtatgac
gatgaagactacaaggatgtttttgtgtcagaggcttgcttgctcactcgcgacgagaac
gagtggtacagggaaccaatctcggccaatgccacgtctggcaaagaaggtttgcaagcc
tcggttgctgactga

DBGET integrated database retrieval system