KEGG   Zea mays (maize): 100282795Help
Entry
100282795         CDS       T01088                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L3 (EC:3.4.19.12)
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
zma  Zea mays (maize)
Brite
Enzymes [BR:zma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100282795
Peptidases [BR:zma01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   100282795
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 225 aa AA seqDB search
MVKRWLPLEANPDVMNQFMWGLGVPEDVGFCDVYGLDDELLAMVPQPVLAVLLLYPQDRS
KESQASATSSVETKEPSKNVYFTKQTVGNACGTVGIIHALGNATSRIKLGEGSYFDRFYK
RTADMDPIQRAAFLEEDEEMENAHSIAATAGDTEAKDGVIEHYICFSCVDGELYELDGGT
SQPIPHGPSTPDTLLQDAAEVIKARIAMYSQSNNFNVMALSGKAI
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagcggtggcttcccctcgaggccaaccccgacgtcatgaaccagttcatgtgg
ggactgggggtccccgaggacgtggggttctgcgacgtgtacggcctcgatgacgagttg
ctcgccatggtgccccagccggtgctcgcggtcctacttctctacccccaggaccggagc
aaggagtcccaagcttcagctacctcgtcggtggagaccaaggagcccagcaagaacgta
tatttcacaaagcaaactgttgggaatgcctgtggcacagttggtattattcatgcactg
gggaatgctacttccagaatcaagttaggtgaggggtcatattttgatagattttataaa
cgaactgctgacatggatcctatccagcgtgctgcatttcttgaggaggacgaggaaatg
gagaatgctcattccattgccgctactgctggtgacacagaggccaaggacggtgtaatt
gaacattacatttgtttctcttgtgtcgatggagagctttatgagcttgatggggggaca
tcacagccaataccccatgggccttccactcctgataccttgttgcaggatgctgcagaa
gttataaaagcaagaatcgccatgtattcgcagtcaaacaacttcaatgtcatggctctt
tcaggcaaagcgatatag

DBGET integrated database retrieval system