KEGG   Zea mays (maize): 100282921Help
Entry
100282921         CDS       T01088                                 

Definition
alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
zma  Zea mays (maize)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100282921
Enzymes [BR:zma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     100282921
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 446 aa AA seqDB search
MADTFALLLLLILSSSVRAAPDAVVSRIAFGSCANQSEPQPIWNAVAGFDPQVFVWLGDN
VYGDNKRPFRVFGRERTVGPWKNVPRFYPSTEEELRRRYQLARAQPGYARLRERAQVLGT
WDDHDYGLNDAGKELSGKVIAQRLMLDFLDEPEDSKRRKQAGVYASYMFGPEGKRVKVIL
LDTRYHRDPLLSDGTILGDPQWQWLERELHGPQSEITIIGSSIQVVSNLSATTGPLFYVE
SWARFPRERERLFRLIDSSKRPGVLFISGDVHFGEITRFDCGAQYPSYDVTSSGLTQSVE
NSVPEVFQPLMRLLAILTPTTMRVLSPNCQYKSCTIGQPNFGAIEIDWNAVPPRIKLELR
DVEGHSVHSVEFPISELQPSEAHAIKRQTHTFQRHCTLETELPWLTRYRLALMLFVIIAV
FAVVVVMLAIACLSNFTKSSKKSKKE
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggcggacactttcgccctcctccttctcctgatcctgtcctcgtcggtccgcgccgcc
cccgacgccgtggtgtcgagaatcgccttcggatcctgcgccaaccagagcgagccccag
cccatttggaacgccgtcgcggggttcgacccgcaggtgttcgtctggctcggggacaac
gtctacggcgacaacaagcgcccattccgggtcttcgggagggagcgcaccgtggggccc
tggaagaacgtgccgcgcttctacccttccaccgaggaggagctgcggaggcggtaccag
ctcgccagggcgcagcccgggtacgccaggctcagggagagggctcaggttcttggaaca
tgggatgaccatgattatggattgaatgatgcaggaaaagaacttagtgggaaagtgatt
gctcaaaggcttatgttagatttcttggatgaacctgaagacagtaaacggaggaaacaa
gctggtgtttatgcctcatacatgtttggccctgaaggaaaacgtgtgaaggtaatcttg
ctggataccagatatcacagagacccgctattaagtgatggaactattctgggagatccc
cagtggcagtggctagagagggagcttcatggtccacaatcagagatcaccatcattgga
tcttcgatccaggtagtgtctaatctttcagccactactgggcctttgttctatgtggag
tcctgggcacgcttcccgagggagagagaaaggctgttcagattgattgatagtagtaag
agacctggagtgctatttattagtggggatgtccatttcggagaaatcaccagattcgat
tgtggagctcaatacccatcatatgatgttacttcgagtggtcttacccagtctgtcgag
aactctgtgccagaagtgtttcaacctcttatgagacttctggcaatactaacaccaact
accatgcgagttttgagcccaaattgccaatataaatcatgtacaataggccaaccaaat
tttggagcgattgaaattgattggaacgctgtacctccgcggattaaacttgaactaaga
gatgttgagggtcattctgttcacagcgtagagttccctatatctgaactgcagccctcg
gaagcgcatgcaatcaaaagacaaacccatactttccaacgtcactgtactctcgaaaca
gagctcccatggctaacacgataccggcttgctctgatgttgtttgtcatcatagctgtt
tttgcggtggttgtggtgatgctagcgatcgcctgcttgtcaaactttaccaagtccagt
aagaaaagcaagaaggaatag

DBGET integrated database retrieval system