KEGG   Zea mays (maize): 100283013Help
Entry
100283013         CDS       T01088                                 

Gene name
pco094064
Definition
LOC100283013
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
zma  Zea mays (maize)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:zma00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    100283013 (pco094064)
Enzymes [BR:zma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100283013 (pco094064)
Protein phosphatases and associated proteins [BR:zma01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100283013 (pco094064)
Transcription machinery [BR:zma03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100283013 (pco094064)
Spliceosome [BR:zma03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100283013 (pco094064)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 377 aa AA seqDB search
MMDPALLDDVIRRLLEVKNLKPGKNAQLSESEIKQLCAAAKEIFLHQPNLLELEAPIKIC
GDVHGQYSDLLRLFDYGGYPPQANYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFLLR
GNHECASVNRIYGFYDECKRRFSVKLWKTFTDCFNCLPVSALIDEKILCMHGGLSPELNK
LEQILNLSRPTDVPDTGLLCDLLWSDPSNEATGWAINDRGVSYTFGPDKVSEFLEKHDLD
LICRAHQVVEDGYEFFASRQLVTMFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPARKV
LGGSTNNKIRLQVIERMVTMASLISGWLVSSTPVVDGGLFHHNHITAAATDRPNASSLPC
WINTLVMYYLLCGSERM
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgatggatccggccttgcttgacgacgtcatacgccggctgctggaggtgaagaatctc
aagcctgggaagaacgcgcagttgtcggagtcggagatcaagcagctctgcgctgccgcc
aaggagatcttcctgcaccagcccaacctgctggagctcgaggcgcccatcaaaatctgc
ggtgatgtccatggccagtactctgatctcctgaggctattcgattatggtggctatccg
cctcaggccaactaccttttcttgggtgattatgtggatcgtggaaagcaaagcttggaa
acaatatgtcttcttttggcctacaaggtcaagtacccagagaacttctttcttctaagg
ggaaaccatgaatgcgcatcagtaaatcgcatctatggtttttatgacgagtgcaaacgc
agattcagtgtaaagctgtggaaaacattcactgactgttttaactgcttgccagtgtca
gcattgatagacgaaaagatcctctgtatgcatggtggtctatctccagagttgaacaag
ctcgaacaaatacttaatctgagtcgccccacagacgtgcctgatactggattgctctgt
gaccttctttggtctgatccttctaatgaagcaacaggatgggccataaatgatcgaggt
gtttcatatacatttggtcctgataaagtttctgaattccttgagaagcatgatttggac
ctcatctgccgagcccatcaggttgtcgaagatggatatgagtttttcgctagccgccaa
ctcgtaacaatgttttcagcccctaactactgtggagaatttgataacgctggtgccatg
atgagtgtagatgagacattgatgtgctccttccaaatactgaaacctgcgaggaaggtg
ttgggtggttcaactaataacaaaatcaggcttcaagtcatcgagaggatggtgacaatg
gcaagcctgatatcaggttggttggtgagcagcacgccagtggtcgacggggggttgttc
catcataatcatattacagcggctgcaactgacaggcccaatgcatcttctcttccatgt
tggatcaacactcttgtaatgtattatttactgtgcggatctgagaggatgtga

DBGET integrated database retrieval system