KEGG   Zea mays (maize): 100283013Help
Entry
100283013         CDS       T01088                                 

Gene name
pco094064
Definition
LOC100283013
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
zma  Zea mays (maize)
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:zma03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 377 aa AA seqDB search
MMDPALLDDVIRRLLEVKNLKPGKNAQLSESEIKQLCAAAKEIFLHQPNLLELEAPIKIC
GDVHGQYSDLLRLFDYGGYPPQANYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFLLR
GNHECASVNRIYGFYDECKRRFSVKLWKTFTDCFNCLPVSALIDEKILCMHGGLSPELNK
LEQILNLSRPTDVPDTGLLCDLLWSDPSNEATGWAINDRGVSYTFGPDKVSEFLEKHDLD
LICRAHQVVEDGYEFFASRQLVTMFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPARKV
LGGSTNNKIRLQVIERMVTMASLISGWLVSSTPVVDGGLFHHNHITAAATDRPNASSLPC
WINTLVMYYLLCGSERM
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgatggatccggccttgcttgacgacgtcatacgccggctgctggaggtgaagaatctc
aagcctgggaagaacgcgcagttgtcggagtcggagatcaagcagctctgcgctgccgcc
aaggagatcttcctgcaccagcccaacctgctggagctcgaggcgcccatcaaaatctgc
ggtgatgtccatggccagtactctgatctcctgaggctattcgattatggtggctatccg
cctcaggccaactaccttttcttgggtgattatgtggatcgtggaaagcaaagcttggaa
acaatatgtcttcttttggcctacaaggtcaagtacccagagaacttctttcttctaagg
ggaaaccatgaatgcgcatcagtaaatcgcatctatggtttttatgacgagtgcaaacgc
agattcagtgtaaagctgtggaaaacattcactgactgttttaactgcttgccagtgtca
gcattgatagacgaaaagatcctctgtatgcatggtggtctatctccagagttgaacaag
ctcgaacaaatacttaatctgagtcgccccacagacgtgcctgatactggattgctctgt
gaccttctttggtctgatccttctaatgaagcaacaggatgggccataaatgatcgaggt
gtttcatatacatttggtcctgataaagtttctgaattccttgagaagcatgatttggac
ctcatctgccgagcccatcaggttgtcgaagatggatatgagtttttcgctagccgccaa
ctcgtaacaatgttttcagcccctaactactgtggagaatttgataacgctggtgccatg
atgagtgtagatgagacattgatgtgctccttccaaatactgaaacctgcgaggaaggtg
ttgggtggttcaactaataacaaaatcaggcttcaagtcatcgagaggatggtgacaatg
gcaagcctgatatcaggttggttggtgagcagcacgccagtggtcgacggggggttgttc
catcataatcatattacagcggctgcaactgacaggcccaatgcatcttctcttccatgt
tggatcaacactcttgtaatgtattatttactgtgcggatctgagaggatgtga

DBGET integrated database retrieval system