KEGG   Zea mays (maize): 100283069Help
Entry
100283069         CDS       T01088                                 

Gene name
cl581_1
Definition
LOC100283069
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
zma  Zea mays (maize)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:zma00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 468 aa AA seqDB search
MGALEEAHLAAAACACEEEEESDYIGLLAGEAAAGDAVEPAVRALLLGLGEDDRREGLLR
TPKRVAKAFRDGTRGYRQKVKDIVQGALFPEVGVDKRTGSAGGTGGQVVVRDIELFSYCE
SCLLPFSIQCHVGYVPSGGRVVGLSKLSRVSDVFAKRLQNPQRLANEICGALHASIQPAG
VAVALQCWHIPLPENLECKTLEGWIRTSHSSRSGVFEGESSTFWTDFLALVKLRGIDVEA
KDHTVSIPWCPLRSHEVLLSNGLCKKNSTNGMVSAVTSMLLSLGEDPLRKELLGTPQRYV
QWLMKFKACNLLDVKLNGFTLSNVSLYERLGGGTTDHGAIRSELHLPFCAQCEHHLLPFY
GVVHIGYFDNGSGEGIDRSHFQALVHFYGCKLQVQERMTRQIAEAVYSVSHHGAMVVVEA
NHICMISRGIEKIRSNTATIAVLGQFLADPSAKACFLQNVLDSVGSAV
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgggagcgctcgaggaggcccacctcgcggccgccgcgtgcgcgtgcgaggaggaggag
gaaagcgactacatcggcctcctcgcaggggaagcggcggcgggcgacgccgtggagccg
gccgtgcgcgccctgctgctggggctcggtgaggacgaccgccgcgagggcctgctccgg
acgcccaagcgcgtcgccaaggccttccgcgacggcacccgaggctacaggcaaaaagta
aaagacatagtgcaaggtgctctgtttccagaggttggtgtggataaaaggactggatct
gctggtggaactggcgggcaagtagttgttcgagacattgaacttttctcctattgtgag
tcatgcttgcttccattcagcatacagtgccatgtcgggtatgttccctcaggtggaaga
gtggttgggttaagcaagctttctagagtatctgatgtctttgccaagagattgcaaaac
cctcaaagactagctaatgaaatctgtggtgcactgcatgctagcattcaacctgccggc
gtggctgttgctctgcagtgctggcacattcctttaccagaaaacttggaatgcaagact
ttggaaggttggattagaacttcacattcatctcgctctggagtctttgaaggtgaaagc
agcactttctggactgacttcttggctcttgttaagcttaggggcatagacgtggaggct
aaggaccatactgtttctattccttggtgccctttaaggtctcatgaggttctactctct
aacgggctctgcaagaaaaactcaactaatggcatggtttctgctgttacctcgatgctc
ttatcactcggagaggaccccctcaggaaagagcttttaggcactcctcagcgttatgtg
cagtggctgatgaagttcaaagcatgtaatctactagacgtgaagctgaatggttttaca
cttagtaatgttagcttatatgagaggctaggtggaggcacaactgatcatggagcaatc
cgatcggagctgcacttgccattttgtgctcaatgtgaacaccatcttctgcccttctac
ggagtagttcacattgggtactttgacaatggaagcggagaaggcattgatcggtcgcat
tttcaggcgttggttcatttctacgggtgcaagcttcaggttcaagaaaggatgacaagg
cagatagctgaagcggtttattcggtttcgcaccatggggccatggtcgttgttgaggcc
aaccacatttgcatgatctcaagggggatagagaaaataaggagcaacacggcaacaatt
gcagttttgggccagtttttggccgacccttctgccaaggcgtgcttcttacaaaatgtt
ttggattctgttggttctgcggtatga

DBGET integrated database retrieval system