KEGG   Zea mays (maize): 100283110Help
Entry
100283110         CDS       T01088                                 

Definition
profilin A
Orthology
K05759  
profilin
Organism
zma  Zea mays (maize)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 132 aa AA seqDB search
MSWQTYVDEHLMCEVEGHHHLTSAAIIGHDGTVWAQSAAFPLFKPEEMANVMKDFDEPGF
LAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGEALVVGIYDEPMTPGQCNMVV
ERLGDYLVEQGL
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcagacctacgtcgacgagcacctcatgtgcgaggtcgagggccaccaccac
ctcacctccgccgccatcatcggccacgacggcaccgtctgggcccagagcgccgcattc
ccgctgttcaagcctgaggagatggccaacgtcatgaaggacttcgacgagcccgggttc
ctggctccgaccggcctcttcctcggccccaccaagtacatggtcatccagggcgagccc
ggcgccgtcatccgcgggaagaagggatctggaggcataaccgtgaagaagaccggggag
gcgctggtggtcggcatctacgacgagcccatgacccccgggcagtgcaacatggtggtc
gagaggctcggcgactacctcgtagagcaaggcctgtaa

DBGET integrated database retrieval system